Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
Funding $2,543,402.78
PubMed Score 983.98
PubTator Score 788.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.643 0.026

Gene RIF (5)

PMID Text
21141873 The study presents the first spectroscopic evidence of the formation of an intermediate with absorbance features resembling those of a flavosemiquinone in the oxidative half-reaction of glycolate oxidase.
20189245 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20054120 The inhibitor heteroatoms interact with five active-site residues that have been implicated in catalysis in homologous flavodehydrogenases of L-2-hydroxy acids. In addition, the chlorophenyl substituent is surrounded by nonconserved hydrophobic residues.
18215067 Active site and loop 4 movements within human glycolate oxidase.
17669354 These inhibitions suggest that glycolate binds to the active site of the reduced enzyme, and that DCIP also has affinity for the oxidized enzyme.

AA Sequence

MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR      1 - 70
VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT     71 - 140
KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA    141 - 210
KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE    211 - 280
AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ    281 - 350
NVKVIDKTLVRKNPLAVSKI                                                      351 - 370
//

Publication (17)

PMID Year Title
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
21141873 2011 Stabilization of an intermediate in the oxidative half-reaction of human liver glycolate oxidase.
20189245 2010 Genome-wide association study of childhood acute lymphoblastic leukemia in Korea.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20054120 2009 Structure of human glycolate oxidase in complex with the inhibitor 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole.
18215067 2008 Active site and loop 4 movements within human glycolate oxidase: implications for substrate specificity and drug design.
17669354 2007 Purification and characterization of recombinant human liver glycolate oxidase.
More...