Property Summary

Ligand Count 9
NCBI Gene PubMed Count 16
PubMed Score 1057.27
PubTator Score 788.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Primary hyperoxaluria 15 4.056 2.0
diabetes mellitus 1728 3.189 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.643 2.6e-02

Synonym

Accession Q9UJM8 Q14CQ0 Q9UPZ0 Q9Y3I7 HAOX1
Symbols GOX
GOX1
HAOX1

Gene

PANTHER Protein Class (2)

PDB

2NZL   2RDT   2RDU   2RDW   2W0U  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQR      1 - 70
VSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVT     71 - 140
KKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVA    141 - 210
KAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVE    211 - 280
AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ    281 - 350
NVKVIDKTLVRKNPLAVSKI                                                      351 - 370
//

Text Mined References (17)

PMID Year Title