Property Summary

NCBI Gene PubMed Count 61
Grant Count 26
R01 Count 7
Funding $1,116,897.38
PubMed Score 72.21
PubTator Score 60.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (46)

PMID Text
26967478 MIG6 down regulation may promote the migration and invasiveness of MEK inhibited mutant NRAS melanoma.
26450625 Upregulation of mitogen-inducible gene 6 triggers antitumor effect and attenuates progesterone resistance in endometrial carcinoma cells
26280531 Crystal structures of human EGFR-Mig6 complexes show how Mig6 rearranges after phosphorylation by EGFR to effectively irreversibly inhibit the same receptor that catalyzed its phosphorylation.
26239118 study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator.
26065894 MIG-6 efficiently reduces cellular transformation driven by oncogenic BRAF by orchestrating a negative feedback circuit directed towards the EGFR.
25735773 MIG6 is a potent tumor suppressor for mutant EGFR-driven lung tumor initiation and progression in mice and provides a possible mechanism by which mutant EGFR can partially circumvent this tumor suppressor in human lung adenocarcinoma.
25400829 Demonstrate that Mig-6 could reverse gefitinib resistance through inhibition of EGFR/ERK pathway in non-small cell lung cancer cell lines.
24830724 The TGFbeta-miR200-MIG6 pathway orchestrates the EMT-associated kinase switch that induces resistance to EGFR inhibitors.
24815188 Mig-6 reduces pRb phosphorylation at Ser249/ Thr252 in both primary and B-Raf V600E oncogene expressing.
24573418 Mig-6 is a potential biomarker for evaluation of tumor prognosis of lung cancer.
More...

AA Sequence

MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHA      1 - 70
SKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLF     71 - 140
PCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYA    141 - 210
YFDTPAVSAADLSYVSDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDK    211 - 280
PEVPPRVPIPPRPVKPDYRRWSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQ    281 - 350
SFAPDPKYVSSKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG    351 - 420
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP                                421 - 462
//

Publication (68)

PMID Year Title
26967478 2016 MIG6 Is MEK Regulated and Affects EGF-Induced Migration in Mutant NRAS Melanoma.
26450625 2015 Upregulation of mitogen-inducible gene 6 triggers antitumor effect and attenuates progesterone resistance in endometrial carcinoma cells.
26280531 2015 Structure and mechanism of activity-based inhibition of the EGF receptor by Mig6.
26239118 2015 DNAJB1 negatively regulates MIG6 to promote epidermal growth factor receptor signaling.
26065894 2015 Mitogen-Inducible Gene-6 Mediates Feedback Inhibition from Mutated BRAF towards the Epidermal Growth Factor Receptor and Thereby Limits Malignant Transformation.
25735773 2015 Loss of MIG6 Accelerates Initiation and Progression of Mutant Epidermal Growth Factor Receptor-Driven Lung Adenocarcinoma.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25400829 2014 Mig-6 overcomes gefitinib resistance by inhibiting EGFR/ERK pathway in non-small cell lung cancer cell lines.
24830724 2014 The TGF?-miR200-MIG6 pathway orchestrates the EMT-associated kinase switch that induces resistance to EGFR inhibitors.
24815188 2014 Mig-6 participates in the regulation of cell senescence and retinoblastoma protein phosphorylation.
More...