Property Summary

NCBI Gene PubMed Count 61
PubMed Score 72.21
PubTator Score 60.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pituitary cancer 1972 9.89546172539958E-10
juvenile dermatomyositis 1189 1.36317077845867E-9
acute quadriplegic myopathy 1157 1.20155663459667E-8
lung carcinoma 2844 3.95859120613279E-8
Duchenne muscular dystrophy 602 4.54443205721553E-7
psoriasis 6685 3.61559052842147E-6
Amyotrophic Lateral Sclerosis 432 1.94861559886756E-5
medulloblastoma, large-cell 6234 2.32333252962053E-4
breast carcinoma 1614 5.5854425024417E-4
ulcerative colitis 2087 6.62708398476815E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0011540490970252
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00187470951407408
limb girdle muscular dystrophy 2B 74 0.00294746361419487
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00501445920864278
adrenocortical carcinoma 1427 0.00703112449366262
ovarian cancer 8492 0.0166531200279391
invasive ductal carcinoma 2950 0.0203067399301625
interstitial lung disease 292 0.0244645357074761
adult high grade glioma 2148 0.0253038241903239
chronic rhinosinusitis 512 0.0279599586160149
inflammatory breast cancer 404 0.0344113696945086
gastric carcinoma 832 0.0354522697752328
mucosa-associated lymphoid tissue lymphoma 480 0.0387849241564329
subependymal giant cell astrocytoma 2287 0.039520287902794
pancreatic ductal adenocarcinoma liver metastasis 1795 0.045038766773367
Disease Target Count Z-score Confidence
Atrial heart septal defect 15 3.288 1.6

Expression

Synonym

Accession Q9UJM3 B2RDX9 Q9NTG9 Q9UD05
Symbols MIG6
RALT
MIG-6
GENE-33

Gene

PDB

2RF9   2RFD   2RFE   4I21   4R3P   4R3R   4ZJV  

  Ortholog (8)

Gene RIF (46)

PMID Text
26967478 MIG6 down regulation may promote the migration and invasiveness of MEK inhibited mutant NRAS melanoma.
26450625 Upregulation of mitogen-inducible gene 6 triggers antitumor effect and attenuates progesterone resistance in endometrial carcinoma cells
26280531 Crystal structures of human EGFR-Mig6 complexes show how Mig6 rearranges after phosphorylation by EGFR to effectively irreversibly inhibit the same receptor that catalyzed its phosphorylation.
26239118 study provides a new molecular mechanism to regulate EGFR signaling through modulation of MIG6 by DNAJB1 as a negative regulator.
26065894 MIG-6 efficiently reduces cellular transformation driven by oncogenic BRAF by orchestrating a negative feedback circuit directed towards the EGFR.
25735773 MIG6 is a potent tumor suppressor for mutant EGFR-driven lung tumor initiation and progression in mice and provides a possible mechanism by which mutant EGFR can partially circumvent this tumor suppressor in human lung adenocarcinoma.
25400829 Demonstrate that Mig-6 could reverse gefitinib resistance through inhibition of EGFR/ERK pathway in non-small cell lung cancer cell lines.
24830724 The TGFbeta-miR200-MIG6 pathway orchestrates the EMT-associated kinase switch that induces resistance to EGFR inhibitors.
24815188 Mig-6 reduces pRb phosphorylation at Ser249/ Thr252 in both primary and B-Raf V600E oncogene expressing.
24573418 Mig-6 is a potential biomarker for evaluation of tumor prognosis of lung cancer.
More...

AA Sequence

MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHA      1 - 70
SKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCASTPPLTPIKNSPSLF     71 - 140
PCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYA    141 - 210
YFDTPAVSAADLSYVSDQNGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDK    211 - 280
PEVPPRVPIPPRPVKPDYRRWSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQ    281 - 350
SFAPDPKYVSSKALQRQNSEGSASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG    351 - 420
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP                                421 - 462
//

Text Mined References (68)

PMID Year Title
26967478 2016 MIG6 Is MEK Regulated and Affects EGF-Induced Migration in Mutant NRAS Melanoma.
26450625 2015 Upregulation of mitogen-inducible gene 6 triggers antitumor effect and attenuates progesterone resistance in endometrial carcinoma cells.
26280531 2015 Structure and mechanism of activity-based inhibition of the EGF receptor by Mig6.
26239118 2015 DNAJB1 negatively regulates MIG6 to promote epidermal growth factor receptor signaling.
26065894 2015 Mitogen-Inducible Gene-6 Mediates Feedback Inhibition from Mutated BRAF towards the Epidermal Growth Factor Receptor and Thereby Limits Malignant Transformation.
25735773 2015 Loss of MIG6 Accelerates Initiation and Progression of Mutant Epidermal Growth Factor Receptor-Driven Lung Adenocarcinoma.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25400829 2014 Mig-6 overcomes gefitinib resistance by inhibiting EGFR/ERK pathway in non-small cell lung cancer cell lines.
24830724 2014 The TGF?-miR200-MIG6 pathway orchestrates the EMT-associated kinase switch that induces resistance to EGFR inhibitors.
24815188 2014 Mig-6 participates in the regulation of cell senescence and retinoblastoma protein phosphorylation.
More...