Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.29
PubTator Score 2.68

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.9e-08
osteosarcoma 7950 1.3e-05


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.396 1.3e-05
ovarian cancer 2.200 8.9e-08


Accession Q9UJK0 Q6PJT8
Symbols C16orf42


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

SSCCEEEQTQGRGAEARAPAEVWKGIKKRQRD                                          281 - 312

Text Mined References (8)

PMID Year Title