Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q9UJJ7 D3DU66
Symbols RLUCL
C16orf40

Gene

PDB

5VBB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEPGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPELADPDTCYGFRFCHQLDFST      1 - 70
SGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRVTISHAIGRNSTEGRAHTMCIEGSQGCEN     71 - 140
PKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHPVVGDLTYGEVSGREDRPFRMMLHA    141 - 210
FYLRIPTDTECVEVCTPDPFLPSLDACWSPHTLLQSLDQLVQALRATPDPDPEDRGPRPGSPSALLPGPG    211 - 280
RPPPPPTKPPETEAQRGPCLQWLSEWTLEPDS                                          281 - 312
//

Text Mined References (7)

PMID Year Title