Property Summary

NCBI Gene PubMed Count 7
PubMed Score 18.43
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.100 1.1e-20
Astrocytoma, Pilocytic 1.400 5.0e-07
atypical teratoid / rhabdoid tumor -1.700 1.1e-03
Breast cancer 1.300 1.3e-07
breast carcinoma 1.100 7.1e-03
ductal carcinoma in situ 1.100 4.0e-02
ependymoma 1.600 3.8e-02
group 3 medulloblastoma -2.300 1.5e-05
invasive ductal carcinoma 1.800 7.9e-04
medulloblastoma, large-cell -3.300 1.3e-07
oligodendroglioma 1.400 3.2e-02
subependymal giant cell astrocytoma 1.455 1.3e-02

Gene RIF (2)

AA Sequence

MGFPAAALLCALCCGLLAPAARAGYSEERCSWRGSGLTQEPGSVGQLALACAEGAVEWLYPAGALRLTLG      1 - 70
GPDPRARPGIACLRPVRPFAGAQVFAERAGGALELLLAEGPGPAGGRCVRWGPRERRALFLQATPHQDIS     71 - 140
RRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAELLLAACTSDFVIHGIIHGVTHDVELQESVITV    141 - 210
VAARVLRQTPPLFQAGRSGDQGLTSIRTPLRCGVHPGPGTFLFMGWSRFGEARLGCAPRFQEFRRAYEAA    211 - 280
RAAHLHPCEVALH                                                             281 - 293
//

Text Mined References (7)

PMID Year Title