Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 1.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
breast carcinoma 1614 5.09626141508572E-36
Breast cancer 3099 3.66407449187612E-14
non-small cell lung cancer 2798 3.60300150241576E-11
psoriasis 6685 7.88280511679284E-10
pediatric high grade glioma 2712 5.98685344351071E-7
medulloblastoma, large-cell 6234 1.27120467320603E-6
atypical teratoid / rhabdoid tumor 4369 2.31401949750599E-6
group 3 medulloblastoma 2254 3.29444029430036E-6
ulcerative colitis 2087 5.8999367266486E-6
interstitial cystitis 2299 6.79171847925579E-5
glioblastoma 5572 7.41774628661601E-5
invasive ductal carcinoma 2950 2.48596375640141E-4
nasopharyngeal carcinoma 1056 2.50249922376427E-4
pancreatic carcinoma 567 2.92353627079297E-4
pancreatic cancer 2300 2.92353627079299E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.08089803282467E-4
primitive neuroectodermal tumor 3031 5.2496327604878E-4
gastric cancer 436 0.00347467178385901
osteosarcoma 7933 0.00376104934765983
astrocytic glioma 2241 0.0096727339377648
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0112324115617824
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0192114594354102
ependymoma 2514 0.0265683204525489
urothelial carcinoma 318 0.0390783515910442
spina bifida 1064 0.0391369102637595
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

Gene

PDB

2CT6  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of SH3 domain binding glutamate-rich protein like 2 (SH3BGRL2) in human primary T cells
20522523 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIF      1 - 70
NGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP                                      71 - 107
//

Text Mined References (13)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
21269460 2011 Initial characterization of the human central proteome.
20522523 2010 Common genetic variation and susceptibility to partial epilepsies: a genome-wide association study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...