Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 1.66

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

2CT6  

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of SH3 domain binding glutamate-rich protein like 2 (SH3BGRL2) in human primary T cells
20522523 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIF      1 - 70
NGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP                                      71 - 107
//

Text Mined References (13)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22773346 2013 Linkage and association of successful aging to the 6q25 region in large Amish kindreds.
21269460 2011 Initial characterization of the human central proteome.
20522523 2010 Common genetic variation and susceptibility to partial epilepsies: a genome-wide association study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...