Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.71
PubTator Score 1.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.600 2.0e-05
astrocytic glioma -1.500 9.7e-03
atypical teratoid / rhabdoid tumor -1.600 2.3e-06
Breast cancer -2.000 3.7e-14
breast carcinoma -1.200 5.1e-36
ependymoma -1.500 2.7e-02
gastric cancer 1.300 3.5e-03
glioblastoma -1.700 5.0e-08
group 3 medulloblastoma -1.400 3.3e-06
interstitial cystitis -1.300 8.9e-04
intraductal papillary-mucinous adenoma (... 1.900 3.1e-04
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
invasive ductal carcinoma -1.800 2.5e-04
medulloblastoma, large-cell -2.000 1.3e-06
nasopharyngeal carcinoma -1.100 2.5e-04
non-small cell lung cancer -1.460 3.6e-11
osteosarcoma -1.735 3.8e-03
pancreatic cancer 2.100 2.9e-04
pancreatic carcinoma 2.100 2.9e-04
pancreatic ductal adenocarcinoma liver m... -1.440 1.9e-02
primitive neuroectodermal tumor -1.100 5.2e-04
psoriasis -1.400 7.9e-10
spina bifida -2.080 3.9e-02
ulcerative colitis -1.600 5.9e-06
urothelial carcinoma -1.200 3.9e-02

Gene RIF (2)

AA Sequence

MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIF      1 - 70
NGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP                                      71 - 107
//

Text Mined References (13)

PMID Year Title