Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.64
PubTator Score 9.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.113794287671E-29
non-small cell lung carcinoma 413 3.9922876352819E-20
posterior fossa group A ependymoma 1511 1.52329250031009E-12
pilocytic astrocytoma 3086 2.08417606295151E-9
adult high grade glioma 2148 1.36098717008789E-6
glioblastoma 5572 2.5103792645555E-6
sonic hedgehog group medulloblastoma 1482 3.29396187698841E-6
medulloblastoma, large-cell 6234 7.17283776573191E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 4.01455928493281E-4
interstitial cystitis 2299 7.89442373495068E-4
atypical teratoid / rhabdoid tumor 4369 9.14061369287696E-4
lung cancer 4473 9.3639173112651E-4
primitive neuroectodermal tumor 3031 9.63276732022381E-4
astrocytic glioma 2241 0.00119252358980339
invasive ductal carcinoma 2950 0.00699635134005821
oligodendroglioma 2849 0.00839653341463023
osteosarcoma 7933 0.0122677576377207
pancreatic cancer 2300 0.0163921345718906
ductal carcinoma in situ 1745 0.0187123111813765
acute myeloid leukemia 785 0.0216338123196836
subependymal giant cell astrocytoma 2287 0.0338061163741451
spina bifida 1064 0.0356592388983131
Disease Target Count Z-score Confidence
Batten disease 15 4.316 2.2
Syndromic intellectual disability 9 3.519 1.8

Expression

Synonym

Accession Q9UJC3 A8K8E9 A8MU44 B4DX15 O60561 Q5TG44 h-hook1
Symbols HK1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
25331952 SHP2 positively regulates TGFbeta1-induced epithelial-mesenchymal transition modulated by its novel interacting protein Hook1.
23589492 Hook1, a microtubule- and cargo-tethering protein, recognized the cytoplasmic tail of CD147 to help sort it and CD98 into Rab22a-dependent tubules associated with recycling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18799622 These data suggest that the FTS/Hook/FHIP complex functions to promote vesicle trafficking and/or fusion via the homotypic vacuolar protein sorting complex.
15471887 novel interactions between the microtubule-binding Hook1 and the large family of Rab GTPases also suggest a link between CLN3 function, microtubule cytoskeleton and endocytic membrane trafficking

AA Sequence

MEETQPPPQPKLPLCDSLMIWLQTFNTASPCQDVKQLTSGVAMAQVLHQIDAAWFNESWLSRIKEDVGDN      1 - 70
WRIKASNVKKVLQGIMSYYHEFLGQQISEALIPDLNQITECSDPVELGRLLQLILGCAINCEKKQEHIQN     71 - 140
IMTLEESVQHVVMTAIQELMSKEILSSPPNDAVGELEQQLKRALEELQEALAEKEELRQRCEELDMQVTT    141 - 210
LQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHCEELEK    211 - 280
QLIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEIYRQKLQDLNDLRKQVKTLQETNMMY    281 - 350
MHNTVSLEEELKKANAARTQLETYKRQVQDLHVKLSSESKRADTLAFEMKRLEEKHEALLKEKERLIEQR    351 - 420
DTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIE    421 - 490
ELQEQLEQKHRKMNELETEQRLSKERIRELQQQIEDLQKSLQEQGSKSEGESSSKLKQKLEAHMEKLTEV    491 - 560
HEELQKKQELIEDLQPDINQNVQKINELEAALQKKDEDMKAMEERYKMYLEKARNVIKTLDPKLNPASAE    561 - 630
IMLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTP    631 - 700
ARSFLAQQRHITNTRRNLSVKVPATTSD                                              701 - 728
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25331952 2014 SHP2 positively regulates TGF?1-induced epithelial-mesenchymal transition modulated by its novel interacting protein Hook1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23589492 2013 Microtubule-dependent endosomal sorting of clathrin-independent cargo by Hook1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18799622 2008 An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex.
More...