Property Summary

NCBI Gene PubMed Count 23
PubMed Score 13.09
PubTator Score 9.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -1.300 2.2e-02
adult high grade glioma -2.600 1.9e-06
astrocytic glioma -2.200 1.3e-02
Astrocytoma, Pilocytic -2.400 2.3e-09
atypical teratoid / rhabdoid tumor -2.500 2.5e-06
ductal carcinoma in situ 1.500 1.9e-02
ependymoma -2.200 2.7e-02
glioblastoma -2.300 2.4e-12
interstitial cystitis -1.500 7.9e-04
invasive ductal carcinoma 1.800 2.6e-03
lung cancer 1.800 9.4e-04
lung carcinoma 2.800 7.1e-29
medulloblastoma -1.500 8.7e-05
medulloblastoma, large-cell -2.100 7.2e-05
non-small cell lung cancer 1.069 5.5e-09
oligodendroglioma -2.200 1.5e-02
osteosarcoma -1.830 1.2e-02
pancreatic cancer -1.100 1.6e-02
pancreatic ductal adenocarcinoma liver m... -2.974 4.0e-04
primitive neuroectodermal tumor -2.400 3.2e-05
spina bifida -1.782 3.6e-02
subependymal giant cell astrocytoma -2.453 3.4e-02

Gene RIF (7)

AA Sequence

MEETQPPPQPKLPLCDSLMIWLQTFNTASPCQDVKQLTSGVAMAQVLHQIDAAWFNESWLSRIKEDVGDN      1 - 70
WRIKASNVKKVLQGIMSYYHEFLGQQISEALIPDLNQITECSDPVELGRLLQLILGCAINCEKKQEHIQN     71 - 140
IMTLEESVQHVVMTAIQELMSKEILSSPPNDAVGELEQQLKRALEELQEALAEKEELRQRCEELDMQVTT    141 - 210
LQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHCEELEK    211 - 280
QLIEFQHRNDELTSLAEETRALKDEIDVLRATSDKANKLESTVEIYRQKLQDLNDLRKQVKTLQETNMMY    281 - 350
MHNTVSLEEELKKANAARTQLETYKRQVQDLHVKLSSESKRADTLAFEMKRLEEKHEALLKEKERLIEQR    351 - 420
DTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIE    421 - 490
ELQEQLEQKHRKMNELETEQRLSKERIRELQQQIEDLQKSLQEQGSKSEGESSSKLKQKLEAHMEKLTEV    491 - 560
HEELQKKQELIEDLQPDINQNVQKINELEAALQKKDEDMKAMEERYKMYLEKARNVIKTLDPKLNPASAE    561 - 630
IMLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTP    631 - 700
ARSFLAQQRHITNTRRNLSVKVPATTSD                                              701 - 728
//

Text Mined References (31)

PMID Year Title