Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.31
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
gastric cancer 1.800 0.006
hepatocellular carcinoma 1.500 0.002
ependymoma -1.500 0.049
oligodendroglioma -2.000 0.050
astrocytoma -1.300 0.000
glioblastoma -1.800 0.009
medulloblastoma -3.400 0.000
cystic fibrosis 1.798 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -3.800 0.000
tuberculosis 1.500 0.011
intraductal papillary-mucinous carcinoma... -2.900 0.001
active Crohn's disease 1.267 0.007
interstitial cystitis -1.700 0.011
pediatric high grade glioma -1.100 0.048
psoriasis -1.800 0.000
nasopharyngeal carcinoma -1.300 0.017
lung carcinoma 1.600 0.000
Alzheimer's disease -1.600 0.027
Pick disease -2.000 0.001
ductal carcinoma in situ 2.500 0.006
ovarian cancer -1.800 0.000
chronic rhinosinusitis -1.956 0.041
type I diabetes mellitus -1.063 0.019

AA Sequence

MTSKFLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFIT      1 - 70
KTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWEEATPIWITNQRAGHTSGAAMWP     71 - 140
GTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISD    141 - 210
IDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFD    211 - 280
EVYEALTHAHPNLTVYKKEDVPERWHYKYNSRIQPIIAVADEGWHILQNKSDDFLLGNHGYDNALADMHP    281 - 350
IFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSV    351 - 420
KPAEYDQEGSYPYFIGVSLGSIIVIVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA                 421 - 477
//

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027689 2001 Structural and catalytic similarities between nucleotide pyrophosphatases/phosphodiesterases and alkaline phosphatases.