Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
R01 Count 6
Funding $652,544
PubMed Score 5.78
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.500 0.018
group 3 medulloblastoma 1.100 0.017
ovarian cancer 2.000 0.000

Gene RIF (1)

PMID Text
18976975 Knockdown of tRNA methyltransferase 6 homolog (TRMT6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTS      1 - 70
GGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTE     71 - 140
FAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCA    141 - 210
GLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPK    211 - 280
DSALVEESNGTLEEKQASEQENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ    281 - 350
EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV    351 - 420
INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKR    421 - 490
KCPESDS                                                                   491 - 497
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16043508 2005 The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
More...