Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.63
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.6e-08
group 3 medulloblastoma 4104 1.7e-02
astrocytic glioma 2597 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bladder urothelial carcinoma 4 3.12 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
group 3 medulloblastoma 1.100 1.7e-02
ovarian cancer 2.000 3.6e-08

Gene RIF (1)

AA Sequence

MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTS      1 - 70
GGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTE     71 - 140
FAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCA    141 - 210
GLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPK    211 - 280
DSALVEESNGTLEEKQASEQENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ    281 - 350
EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV    351 - 420
INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVAMDNLKADTSLKSNASTLESHETEEPAAKKR    421 - 490
KCPESDS                                                                   491 - 497
//

Text Mined References (15)

PMID Year Title