Property Summary

NCBI Gene PubMed Count 42
PubMed Score 28.62
PubTator Score 13.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.417 1.7e-04
atypical teratoid / rhabdoid tumor 1.200 3.7e-03
Breast cancer 1.100 1.9e-08
cystic fibrosis -1.129 8.7e-05
glioblastoma 1.600 2.5e-06
group 3 medulloblastoma 2.100 2.8e-04
invasive ductal carcinoma 1.100 6.7e-04
lung adenocarcinoma 1.400 5.3e-10
medulloblastoma, large-cell 1.900 2.1e-03
nasopharyngeal carcinoma 1.800 4.8e-05
non-small cell lung cancer 1.638 1.3e-19
osteosarcoma -1.675 1.2e-05
ovarian cancer -1.100 9.9e-05
pediatric high grade glioma 1.700 3.6e-05
primitive neuroectodermal tumor 1.600 8.0e-04

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MNGEYRGRGFGRGRFQSWKRGRGGGNFSGKWREREHRPDLSKTTGKRTSEQTPQFLLSTKTPQSMQSTLD      1 - 70
RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPD     71 - 140
IATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNV    141 - 210
RANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSS    211 - 280
PLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDK    281 - 350
CMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELV    351 - 420
KAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVT    421 - 490
LSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAA    491 - 560
NPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNS    561 - 630
QDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQS    631 - 700
QRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGM    701 - 770
SNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM    771 - 840
//

Text Mined References (44)

PMID Year Title