Property Summary

NCBI Gene PubMed Count 37
Grant Count 4
R01 Count 4
Funding $550,449
PubMed Score 25.20
PubTator Score 13.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q9UJA3 B2RBG7 D3DW08 E7EQU7 Q495R4 Q495R6 Q495R7 Q86US4 Q969I5
Symbols POF10
C20orf154
dJ967N21.5

Gene

Gene RIF (14)

PMID Text
26823731 Suggest role for MCM8 in the pathogenesis of chronic myelogenous leukemia.
25873734 MCM8, a component of the pre-replication complex, is crucial for gonadal development and maintenance in humans-both males and females. These
25437880 An autosomal recessive ovarian failure disorder caused by an MCM8 mutation that manifests with endocrine dysfunction and genomic instability.
23401855 Chromatin immunoprecipitation analysis using human DR-GFP cells demonstrated that MCM8 and MCM9 proteins are rapidly recruited to DNA damage sites and promote RAD51 recruitment.
22696150 Single Nucleotide Polymorphism in MCM8 is associated with ovarian follicle number and menopause.
22131368 Single nucleotide polymorphism in MCM8 is associated with menopause and the length of reproductive lifespan.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNGEYRGRGFGRGRFQSWKRGRGGGNFSGKWREREHRPDLSKTTGKRTSEQTPQFLLSTKTPQSMQSTLD      1 - 70
RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPD     71 - 140
IATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNV    141 - 210
RANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSS    211 - 280
PLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDK    281 - 350
CMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELV    351 - 420
KAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVT    421 - 490
LSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAA    491 - 560
NPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNS    561 - 630
QDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQS    631 - 700
QRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGM    701 - 770
SNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM    771 - 840
//

Text Mined References (39)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26823731 2015 Expression of minichromosome maintenance 8 in chronic myelogenous leukemia.
25873734 2015 Minichromosome maintenance complex component 8 (MCM8) gene mutations result in primary gonadal failure.
25437880 2015 Exome sequencing reveals MCM8 mutation underlies ovarian failure and chromosomal instability.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23401855 2013 The MCM8-MCM9 complex promotes RAD51 recruitment at DNA damage sites to facilitate homologous recombination.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...