Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.24
PubTator Score 32.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.40717067150899E-14
ovarian cancer 8492 4.15671881303805E-14
posterior fossa group B ependymoma 1530 6.85159579523459E-9
glioblastoma 5572 2.03078675109246E-7
atypical teratoid/rhabdoid tumor 1095 3.09780070042308E-7
pediatric high grade glioma 2712 3.02240072547721E-6
osteosarcoma 7933 4.39502517470064E-5
group 3 medulloblastoma 2254 0.00424058373206061
Rheumatoid Arthritis 1171 0.0100210447090251
oligodendroglioma 2849 0.0111183790098806
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0139668931742113
subependymal giant cell astrocytoma 2287 0.0298187580539696
gastric carcinoma 832 0.0391014946062966
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0416705377148676
Disease Target Count Z-score Confidence
Leigh disease 81 3.285 1.6

Expression

Synonym

Accession Q9UJA2 D3DW09 E9PAT4 Q27RP0 Q69YQ5 CLS
Symbols CLS
CLS1
GCD10
C20orf155
dJ967N21.6

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (11)

PMID Text
22584571 transgenic expression of cardiolipin synthase attenuated maladaptive cardiolipin remodeling and bioenergetic inefficiency in myocardium rendered diabetic by streptozotocin treatment.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20652826 CLS mRNA levels cannot be correlated with CLS enzyme activity nor CL content in the LPS model of inflammation.
19089659 antibodies occur frequently in viral infections, particularly, in HIV but not in bacterial infections
19089657 associated with Libman-Sacks endocarditis, cardiac manifestation of SLE
19052923 presence of cardiolipin autoantibodies is criteria for diagnostics of antiphospholipid syndrome
19048416 Patients with solid and non-solid malignancies display anticardiolipin antibodies associated with increased rate of thrombosis
19048414 anti-cardiolipin antibody positivity is an independent predictor of chronic renal failure
16888643 We describe here a human gene for CLS and its analysis via RNAi knockdown on apoptotic progression.
16716149 hCLS1 protein was localized to the mitochondria when transiently expressed in COS-7 cells
More...

AA Sequence

MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCS      1 - 70
GAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVF     71 - 140
ALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVF    141 - 210
YVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFT    211 - 280
TAASAYSYYHYGRKTVQVIKD                                                     281 - 301
//

Text Mined References (18)

PMID Year Title
22584571 2012 Myocardial regulation of lipidomic flux by cardiolipin synthase: setting the beat for bioenergetic efficiency.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20652826 2011 Cardiolipin synthase-1 mRNA expression does not correlate with endogenous cardiolipin synthase enzyme activity in vitro and in vivo in mammalian lipopolysaccharide models of inflammation.
19089659 2009 Infections and the antiphospholipid syndrome.
19089657 2009 Revisiting Libman-Sacks endocarditis: a historical review and update.
19052923 2009 Clinical and laboratory features of the catastrophic antiphospholipid syndrome.
19048416 2009 Malignancies and catastrophic anti-phospholipid syndrome.
19048414 2009 Renal involvement in the antiphospholipid syndrome (APS)-APS nephropathy.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16888643 2007 Cardiolipin deficiency releases cytochrome c from the inner mitochondrial membrane and accelerates stimuli-elicited apoptosis.
More...