Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.24
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 6.7e-05
ependymoma 1.300 1.3e-10
gastric carcinoma -1.200 3.9e-02
glioblastoma 1.100 2.0e-07
group 3 medulloblastoma 1.100 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.4e-02
non-small cell lung cancer -1.050 1.4e-14
oligodendroglioma 1.200 1.1e-02
osteosarcoma -1.280 4.4e-05
ovarian cancer -1.400 1.9e-06
pancreatic ductal adenocarcinoma liver m... -2.001 4.2e-02
pediatric high grade glioma 1.100 3.0e-06
Rheumatoid arthritis 1.400 1.0e-02
subependymal giant cell astrocytoma 1.362 3.0e-02

Gene RIF (11)

AA Sequence

MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCS      1 - 70
GAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVF     71 - 140
ALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVF    141 - 210
YVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFT    211 - 280
TAASAYSYYHYGRKTVQVIKD                                                     281 - 301
//

Text Mined References (18)

PMID Year Title