Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.75
PubTator Score 5.35

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.900 3.0e-04
Astrocytoma, Pilocytic -1.600 7.9e-06
atypical teratoid / rhabdoid tumor -1.900 5.6e-09
glioblastoma -1.400 1.6e-05
medulloblastoma, large-cell -1.400 4.1e-03
Multiple Sclerosis 1.100 3.1e-02
osteosarcoma 2.539 1.3e-09
subependymal giant cell astrocytoma -2.014 1.5e-02

Gene RIF (7)

AA Sequence

MRPRPEGRGLRAGVALSPALLLLLLLPPPPTLLGRLWAAGTPSPSAPGARQDGALGAGRVKRGWVWNQFF      1 - 70
VVEEYTGTEPLYVGKIHSDSDEGDGAIKYTISGEGAGTIFLIDELTGDIHAMERLDREQKTFYTLRAQAR     71 - 140
DRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAELSPTGTSVMQVMASDADDPTYGSSARLVYSV    141 - 210
LDGEHHFTVDPKTGVIRTAVPDLDRESQERYEVVIQATDMAGQLGGLSGSTTVTIVVTDVNDNPPRFPQK    211 - 280
MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFES    281 - 350
QPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEFRPPSGLLEVQEDAQVGSLVGVVTARD    351 - 420
PDAANRPVRYAIDRESDLDQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEADNHAQLSRASLRIRIL    421 - 490
DVNDNPPELATPYEAAVCEDAKPGQLIQTISVVDRDEPQGGHRFYFRLVPEAPSNPHFSLLDIQDNTAAV    491 - 560
HTQHVGFNRQEQDVFFLPILVVDSGPPTLSSTGTLTIRICGCDSSGTIQSCNTTAFVMAASLSPGALIAL    561 - 630
LVCVLILVVLVLLILTLRRHHKSHLSSDEDEDMRDNVIKYNDEGGGEQDTEAYDMSALRSLYDFGELKGG    631 - 700
DGGGSAGGGAGGGSGGGAGSPPQAHLPSERHSLPQGPPSPEPDFSVFRDFISRKVALADGDLSVPPYDAF    701 - 770
QTYAFEGADSPAASLSSLHSGSSGSEQDFAYLSSWGPRFRPLAALYAGHRGDDEAQAS                771 - 828
//

Text Mined References (13)

PMID Year Title