Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.27
PubTator Score 5.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.539 0.000
glioblastoma -1.800 0.001
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.400 0.004
Multiple Sclerosis 1.100 0.031
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -2.014 0.015

Gene RIF (6)

PMID Text
20650312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19546606 Our results reveal for the first time a new role of CDH22 in progression of colorectal cancer.
19440036 PRL-3 promoted downregulation of CDH22 expression.
18854154 Knockdown of cadherin 22, type 2 (CDH22) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18602983 Observational study of gene-disease association. (HuGE Navigator)
8626716 This paper deals primarily with the rat ortholog of the human CDH22 gene.

AA Sequence

MRPRPEGRGLRAGVALSPALLLLLLLPPPPTLLGRLWAAGTPSPSAPGARQDGALGAGRVKRGWVWNQFF      1 - 70
VVEEYTGTEPLYVGKIHSDSDEGDGAIKYTISGEGAGTIFLIDELTGDIHAMERLDREQKTFYTLRAQAR     71 - 140
DRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAELSPTGTSVMQVMASDADDPTYGSSARLVYSV    141 - 210
LDGEHHFTVDPKTGVIRTAVPDLDRESQERYEVVIQATDMAGQLGGLSGSTTVTIVVTDVNDNPPRFPQK    211 - 280
MYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFES    281 - 350
QPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEFRPPSGLLEVQEDAQVGSLVGVVTARD    351 - 420
PDAANRPVRYAIDRESDLDQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEADNHAQLSRASLRIRIL    421 - 490
DVNDNPPELATPYEAAVCEDAKPGQLIQTISVVDRDEPQGGHRFYFRLVPEAPSNPHFSLLDIQDNTAAV    491 - 560
HTQHVGFNRQEQDVFFLPILVVDSGPPTLSSTGTLTIRICGCDSSGTIQSCNTTAFVMAASLSPGALIAL    561 - 630
LVCVLILVVLVLLILTLRRHHKSHLSSDEDEDMRDNVIKYNDEGGGEQDTEAYDMSALRSLYDFGELKGG    631 - 700
DGGGSAGGGAGGGSGGGAGSPPQAHLPSERHSLPQGPPSPEPDFSVFRDFISRKVALADGDLSVPPYDAF    701 - 770
QTYAFEGADSPAASLSSLHSGSSGSEQDFAYLSSWGPRFRPLAALYAGHRGDDEAQAS                771 - 828
//

Text Mined References (12)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20650312 2010 Analysis of candidate genes on chromosome 20q12-13.1 reveals evidence for BMI mediated association of PREX1 with type 2 diabetes in European Americans.
19546606 2009 Over-expression of CDH22 is associated with tumor progression in colorectal cancer.
19440036 2009 PRL-3 promotes epithelial mesenchymal transition by regulating cadherin directly.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12630923 2003 Expression of a novel factor, short-type PB-cadherin, in Sertoli cells and spermatogenic stem cells of the neonatal rat testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...