Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.42
PubTator Score 2.03

Knowledge Summary

Patent (2,175)

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession Q9UJ96
Symbols KCNF2
KV6.2

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG

AA Sequence

MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCDDYDVSRDEFF      1 - 70
FDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCLRRLRRREEEAAEARAGPTER     71 - 140
GAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFACVSVSFVAVTAVGLCLSTMPDIRAEEERGE    141 - 210
CSPKCRSLFVLETVCVAWFSFEFLLRSLQAESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLL    211 - 280
ERAGLVLRLLRALRVLYVMRLARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGAR    281 - 350
RDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ    351 - 420
RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR                            421 - 466
//

Text Mined References (4)

PMID Year Title
24143882 2014 Genome-wide association study of opioid dependence: multiple associations mapped to calcium and potassium pathways.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
10551266 1999 Structural and functional characterization of Kv6.2 a new gamma-subunit of voltage-gated potassium channel.