Property Summary

Ligand Count 3
NCBI Gene PubMed Count 4
PubMed Score 2.53
PubTator Score 2.03

Knowledge Summary

Patent (2,175)

TINX Plot

  Disease (3)

Expression

AA Sequence

MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCDDYDVSRDEFF      1 - 70
FDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCLRRLRRREEEAAEARAGPTER     71 - 140
GAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFACVSVSFVAVTAVGLCLSTMPDIRAEEERGE    141 - 210
CSPKCRSLFVLETVCVAWFSFEFLLRSLQAESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLL    211 - 280
ERAGLVLRLLRALRVLYVMRLARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGAR    281 - 350
RDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ    351 - 420
RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR                            421 - 466
//

Text Mined References (4)

PMID Year Title