Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.42
PubTator Score 2.03

Knowledge Summary

Patent (2,175)

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q9UJ96
Symbols KCNF2
KV6.2

Gene

AA Sequence

MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCDDYDVSRDEFF      1 - 70
FDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCLRRLRRREEEAAEARAGPTER     71 - 140
GAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFACVSVSFVAVTAVGLCLSTMPDIRAEEERGE    141 - 210
CSPKCRSLFVLETVCVAWFSFEFLLRSLQAESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLL    211 - 280
ERAGLVLRLLRALRVLYVMRLARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGAR    281 - 350
RDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ    351 - 420
RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR                            421 - 466
//

Text Mined References (4)

PMID Year Title
24143882 2014 Genome-wide association study of opioid dependence: multiple associations mapped to calcium and potassium pathways.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
10551266 1999 Structural and functional characterization of Kv6.2 a new gamma-subunit of voltage-gated potassium channel.