Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9UJ94
Symbols C21orf104

Gene

 Compartment GO Term (0)

AA Sequence

MEGCLRIEEALTLGGACLFAGLAFLWAAFAQHFSAADSPGTEFTPATTTSRLLHVLYVCSCSLVAEKDDF      1 - 70
SSPHSHSLLLVSLPEPHFELSEGLRLAFRGSQSSDSIRYRRGGNEGVRPWRAGATGLPPTGKDISVSLAH     71 - 140
ELYSLLKQLQMSI                                                             141 - 153
//

Text Mined References (1)

PMID Year Title
10830953 2000 The DNA sequence of human chromosome 21.