Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.20
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY      1 - 70
ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE     71 - 140
RV                                                                        141 - 142
//

Text Mined References (17)

PMID Year Title