Property Summary

NCBI Gene PubMed Count 17
Grant Count 8
R01 Count 6
Funding $409,282.49
PubMed Score 7.89
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
21985337 common single nucleotide polymorphism (SNP) from KCNE5, and ECG measurements and survival in postacute acute coronary syndrome patients
21730298 Data show that KCNQ3 and KCNE5 mRNA expressions were significantly upregulated in preeclampsia.
21493962 KCNE5 modulates I(to), and its novel variants appeared to cause IVF, especially BrS, in male patients through gain-of-function effects on I(to). Screening for KCNE5 variants is relevant for BrS or IVF.
18313602 A missense mutation in KCNE5 may be associated with nonfamilial or acquired forms of atrial fibrillation.
18313602 Observational study of gene-disease association. (HuGE Navigator)
16054468 Observational study of gene-disease association. (HuGE Navigator)
15193977 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY      1 - 70
ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE     71 - 140
RV                                                                        141 - 142
//

Text Mined References (17)

PMID Year Title
27484720 2016 KCNE4 and KCNE5: K(+) channel regulation and cardiac arrhythmogenesis.
26242757 2015 Auxiliary KCNE subunits modulate both homotetrameric Kv2.1 and heterotetrameric Kv2.1/Kv6.4 channels.
21985337 2012 KCNE5 polymorphism rs697829 is associated with QT interval and survival in acute coronary syndromes patients.
21730298 2011 Novel expression and regulation of voltage-dependent potassium channels in placentas from women with preeclampsia.
21493962 2011 KCNE5 (KCNE1L) variants are novel modulators of Brugada syndrome and idiopathic ventricular fibrillation.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
18313602 2008 Gain of function in IKs secondary to a mutation in KCNE5 associated with atrial fibrillation.
16303284 2006 Expression and transcriptional control of human KCNE genes.
16054468 2005 Relation of 97T polymorphism in KCNE5 to risk of atrial fibrillation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...