Property Summary

NCBI Gene PubMed Count 15
PubMed Score 63.80
PubTator Score 34.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.100 5.5e-04
lung adenocarcinoma -1.100 2.1e-12
osteosarcoma -1.744 2.7e-05
ovarian cancer -1.300 3.4e-06
pancreatic ductal adenocarcinoma liver m... -2.128 1.7e-03
posterior fossa group B ependymoma 1.100 1.5e-04

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MPDSNFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAACYAASAI      1 - 70
GYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSAR     71 - 140
PSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVI    141 - 210
RNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVVPDNHPYCVGAARSRALQFADVIVLFG    211 - 280
ARLNWILHFGLPPRYQPDVKFIQVDICAEELGNNVKPAVTLLGNIHAVTKQLLEELDKTPWQYPPESKWW    281 - 350
KTLREKMKSNEAASKELASKKSLPMNYYTVFYHVQEQLPRDCFVVSEGANTMDIGRTVLQNYLPRHRLDA    351 - 420
GTFGTMGVGLGFAIAAAVVAKDRSPGQWIICVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFD    421 - 490
TDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSLADTTKPSLINIMIE    491 - 560
PQATRKAQDFHWLTRSNM                                                        561 - 578
//

Text Mined References (22)

PMID Year Title