Property Summary

NCBI Gene PubMed Count 50
PubMed Score 321.54
PubTator Score 144.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.100 3.9e-05
Atopic dermatitis -1.100 1.2e-02
Barrett's esophagus -1.500 2.0e-02
cutaneous lupus erythematosus -2.600 1.2e-02
esophageal adenocarcinoma -1.600 1.8e-02
medulloblastoma, large-cell 1.300 6.6e-05
ovarian cancer 1.100 3.7e-09

Gene RIF (53)

AA Sequence

MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGT      1 - 70
ISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQIL     71 - 140
TRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFS    141 - 210
LIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRF    211 - 280
WIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP                          281 - 328
//

Text Mined References (54)

PMID Year Title