Property Summary

NCBI Gene PubMed Count 43
Grant Count 66
R01 Count 50
Funding $7,544,988.92
PubMed Score 302.84
PubTator Score 144.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus -1.500 0.020
esophageal adenocarcinoma -1.600 0.018
psoriasis -2.100 0.000
cutaneous lupus erythematosus -2.600 0.012
medulloblastoma, large-cell 1.300 0.000
Atopic dermatitis -1.100 0.012
ovarian cancer 1.100 0.000

Synonym

Accession Q9UJ71
Symbols CLEC4K

Gene

PDB

3C22   3KQG   3P5D   3P5E   3P5F   3P5G   3P5H   3P5I   3P7F   3P7G   3P7H   4AK8   4N32   4N33   4N34   4N35   4N36   4N37   4N38  

Gene RIF (47)

PMID Text
26468543 This study is the first to demonstrate that langerin represents an authentic receptor that binds and internalizes influenza A virus to facilitate infection.
25829141 Data suggest that Langerin (CD207)-mediated binding of Yersinia pestis to antigen-presenting cells (APCs) may promote its dissemination and infection.
25747117 Langerin binds heparin (HEP)-like oligosaccharides in two different binding sites depending on the ligand size.
25650933 The impact of two carbohydrate recognition domains mutations, W264R and F241L, on langerin structure, function, and Birbeck granules assembly.
25584868 Cell-sorting experiments demonstrated that IDO1 expression is found in a subset of CD1a(+)CD14(-)langerin(+) cells, expressing CD103
25551286 The authors not only show that langerin and caveolin-1 co-localize at the cell membrane and in vesicles but that caveolin-1 mediated HIV-1 uptake is an intrinsic restriction mechanism present in human Langerhans cells that prevents HIV-1 infection.
25551286 HIV-1 CA co-localizes with langerin and caveolin-1 at the cell membrane of human Langerhans cells
25516751 Langerin is not expressed by freshly isolated CD1c(+) blood DCs but is rapidly induced on CD1c(+) DCs by serum or TGF-beta via an ALK-3-dependent pathway.
25422308 However, the superoxide dismutase C (SodC) protein of the Mycobacterium leprae cell wall was identified as a langerin-reactive ligand.
25407434 HIV-1 CA co-localizes with langerin and caveolin-1 at the cell membrane of human Langerhans cells
More...

AA Sequence

MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGT      1 - 70
ISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQIL     71 - 140
TRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFS    141 - 210
LIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRF    211 - 280
WIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP                          281 - 328
//

Text Mined References (47)

PMID Year Title
26468543 2015 The C-type Lectin Langerin Functions as a Receptor for Attachment and Infectious Entry of Influenza A Virus.
25829141 2015 Host Langerin (CD207) is a receptor for Yersinia pestis phagocytosis and promotes dissemination.
25747117 2015 Langerin-heparin interaction: two binding sites for small and large ligands as revealed by a combination of NMR spectroscopy and cross-linking mapping experiments.
25650933 2015 Alteration of the langerin oligomerization state affects Birbeck granule formation.
25584868 2015 CD103 marks a subset of human CD34+-derived langerin+ dendritic cells that induce T-regulatory cells via indoleamine 2,3-dioxygenase-1.
25551286 2014 Caveolin-1 mediated uptake via langerin restricts HIV-1 infection in human Langerhans cells.
25516751 2015 Langerin-expressing dendritic cells in human tissues are related to CD1c+ dendritic cells and distinct from Langerhans cells and CD141high XCR1+ dendritic cells.
25422308 2015 Carbohydrate-dependent binding of langerin to SodC, a cell wall glycoprotein of Mycobacterium leprae.
25070850 2014 Inhibition of two temporal phases of HIV-1 transfer from primary Langerhans cells to T cells: the role of langerin.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
More...