Property Summary

NCBI Gene PubMed Count 61
Grant Count 143
R01 Count 95
Funding $31,439,924.94
PubMed Score 84.72
PubTator Score 129.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.199 0.012
malignant mesothelioma 1.600 0.000
psoriasis 1.500 0.000
osteosarcoma -1.234 0.003
medulloblastoma, large-cell -1.900 0.000
tuberculosis 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.313 0.014
non-small cell lung cancer -1.245 0.000
lung adenocarcinoma -1.300 0.000
inflammatory breast cancer -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q9UJ68 E9PAS8 Q52TC4 Q549N4 Q66MI7
Symbols PMSR

Gene

PANTHER Protein Class (2)

Gene RIF (45)

PMID Text
26718410 this study we have identified, for the first time, compounds structurally related to the natural products fusaricidins that markedly activate recombinant bovine and human MsrA and human MsrB.
26117066 The association of MsrA haplotypes with executive functions indicated that MsrA is associated with executive function defects in bipolar I disorder patients.
25341044 ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA.
23988788 Silencing the expression of the main Msr elements-MsrA, MsrB1, or MsrB2 exacerbates sensitivity toward oxidative stress.
23880405 The functional MSRA rs10903323 G/A polymorphism is associated with coronary artery disease development.
23415806 We hypothesize that the activity of MsrA can be employed as a marker for the isolation of stem and progenitor cell subpopulations for cell therapy applications.
23333304 HIV-1 Vif downregulates the expression of methionine sulfoxide reductase A (MSRA) in Vif-expression T cells
23244167 The MSRA rs10903323 G/A variant allele is associated with Rheumatoid Arthritis development, especially among male patients, older patients, C-Reactive Protein-positive patients, and anti-cyclic citrullinated peptide negative patients.
22867795 Mammalian and yeast MSRA reduced free methionine sulfoxide much more efficiently than MSRB.
22657383 The MSRA rs10903323 gene polymorphism may be implicated in the increased risk to develop cardiovascular events, in particular ischaemic heart disease, observed in rheumatoid arthritis patients.
More...

AA Sequence

MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF      1 - 70
GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN     71 - 140
HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ    141 - 210
YLSKNPNGYCGLGGTGVSCPVGIKK                                                 211 - 235
//

Text Mined References (65)

PMID Year Title
26718410 2016 Identification of activators of methionine sulfoxide reductases A and B.
26117066 2015 Methionine sulfoxide reductase A (MsrA) associated with bipolar I disorder and executive functions in A Han Chinese population.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25341044 2014 Arrest defective 1 regulates the oxidative stress response in human cells and mice by acetylating methionine sulfoxide reductase A.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
24670271 2014 Association study of common polymorphisms in MSRA, TFAP2B, MC4R, NRXN3, PPARGC1A, TMEM18, SEC16B, HOXB5 and OLFM4 genes with obesity-related traits among Portuguese children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988788 2013 Proteome alteration in oxidative stress-sensitive methionine sulfoxide reductase-silenced HEK293 cells.
23880405 2013 Methionine sulfoxide reductase A rs10903323 G/A polymorphism is associated with increased risk of coronary artery disease in a Chinese population.
23568457 2013 Genetic variants associated with disordered eating.
More...