Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.19
PubTator Score 5.77

Knowledge Summary

Patent (4,071)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 2.66228666418528E-13
ulcerative colitis 2087 1.21603953525523E-5
invasive ductal carcinoma 2950 2.14395677781735E-4
osteosarcoma 7933 3.05576648227801E-4
interstitial cystitis 2299 8.43862853981836E-4
chronic lymphosyte leukemia 232 0.00180663442615982
ovarian cancer 8492 0.00209894830532849
adrenocortical carcinoma 1427 0.0115513936827409
ductal carcinoma in situ 1745 0.0133248265337353
mucosa-associated lymphoid tissue lymphoma 480 0.0172085650034228
oligodendroglioma 2849 0.0258081275458829
pituitary cancer 1972 0.0276607507911013

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma -1.700 0.026
osteosarcoma -3.083 0.000
chronic lymphosyte leukemia -1.100 0.002
adrenocortical carcinoma 1.125 0.012
interstitial cystitis -1.300 0.001
breast carcinoma 1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.131 0.017
ductal carcinoma in situ 2.400 0.013
invasive ductal carcinoma 2.900 0.000
ulcerative colitis -1.300 0.000
ovarian cancer 1.700 0.002
pituitary cancer 1.100 0.028

Synonym

Accession Q9UJ42 D3DNQ2
Symbols GPCR1
GPCR150

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (2)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCISLAFVDLLLL      1 - 70
VNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSKTTKLSFKCQKLFYF     71 - 140
FTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQA    141 - 210
IRITSYMNETILYFPFSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWL    211 - 280
YFVNSFLIATVYWFNCHKLNLKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC                281 - 338
//

Text Mined References (7)

PMID Year Title
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11466977 2000 Mining of assembled expressed sequence tag (EST) data for protein families: application to the G protein-coupled receptor superfamily.