Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.19
PubTator Score 5.77

Knowledge Summary

Patent (4,071)

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma -1.700 0.026
osteosarcoma -3.083 0.000
chronic lymphosyte leukemia -1.100 0.002
adrenocortical carcinoma 1.125 0.012
interstitial cystitis -1.300 0.001
breast carcinoma 1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.131 0.017
ductal carcinoma in situ 2.400 0.013
invasive ductal carcinoma 2.900 0.000
ulcerative colitis -1.300 0.000
ovarian cancer 1.700 0.002
pituitary cancer 1.100 0.028

Gene RIF (2)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCISLAFVDLLLL      1 - 70
VNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSKTTKLSFKCQKLFYF     71 - 140
FTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQA    141 - 210
IRITSYMNETILYFPFSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWL    211 - 280
YFVNSFLIATVYWFNCHKLNLKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC                281 - 338
//

Publication (7)

PMID Year Title
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11466977 2000 Mining of assembled expressed sequence tag (EST) data for protein families: application to the G protein-coupled receptor superfamily.