Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.05
PubTator Score 5.77

Knowledge Summary

Patent (4,071)

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.125 1.2e-02
breast carcinoma 1.400 2.7e-13
chronic lymphosyte leukemia -1.100 1.8e-03
ductal carcinoma in situ 2.400 1.3e-02
interstitial cystitis -1.100 5.0e-02
invasive ductal carcinoma 2.900 2.1e-04
mucosa-associated lymphoid tissue lympho... 1.131 1.7e-02
oligodendroglioma -1.700 2.6e-02
osteosarcoma -3.083 3.1e-04
ovarian cancer 1.700 2.1e-03
pituitary cancer 1.100 2.8e-02
ulcerative colitis -1.300 1.2e-05

Gene RIF (4)

AA Sequence

MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCISLAFVDLLLL      1 - 70
VNISIILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSKTTKLSFKCQKLFYF     71 - 140
FTVILIWISVLAYVLGDPAIYQSLKAQNAYSRHCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQA    141 - 210
IRITSYMNETILYFPFSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWL    211 - 280
YFVNSFLIATVYWFNCHKLNLKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC                281 - 338
//

Text Mined References (9)

PMID Year Title