Property Summary

NCBI Gene PubMed Count 35
Grant Count 3
R01 Count 3
Funding $340,105.58
PubMed Score 20.45
PubTator Score 53.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cardiovascular system disease 194 2.0

Expression

Gene RIF (17)

PMID Text
26430212 The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner.
26002576 RABEX-5 is a potential useful indicator and predicts a poor long-term prognosis for small cell lung cancer(SCLC), which should be considered in defining the prognosis with other well-known prognosticators in C-SCLC patients
25427001 Expression of RABEX-5 is significantly higher in gastric cancer tissues and is associated with tumor size and lymph node metastasis.
24957337 analysis of Rabex-5 GEF activation by Rabaptin-5
24716822 RABEX-5 mRNA expression is a strong predictor of poor prognosis in prostate cancer patients treated by radical prostatectomy.
24714377 This implies that Rap regulates endothelial barrier function by dual control of cytoskeletal tension. The molecular details of the signaling pathways are becoming to be elucidated
23048039 Interaction of Rabex-5 with Rab5 depends on interaction of the MIU domain with the ubiquitinated L1 to drive its internalization.
22952906 KCa2.3 is localized to a caveolin-rich domain within the plasma membrane and is endocytosed in a dynamin- and Rab5-dependent manner.
22846990 a novel mechanistic insight into how Rabex-5 regulates internalization and postendocytic trafficking of ubiquitinated L1 destined for lysosomal degradation.
21500550 RABEX-5 and RAB5 may be involved in the development of breast cancer metastasis.
More...

AA Sequence

MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQERCAEFPALRGPPTQGACSSCVQ      1 - 70
RGPVLCHRAPPGAAGEHAATEGREGAPSVSGTHALLQRPLGADCGDRPAACGPAEGPLCQAQVVSRKKMS     71 - 140
LKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERVLLCCPGWSAMV    141 - 210
QFQLTATSASWAQVILLLQPPKWLGLQKLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVK    211 - 280
KFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRD    281 - 350
LSIEEQSECAQDFYHNVAERMQTRGKERRFHHVGQAGLELLTSGDPPASASQSAGNTGVEPPHPAVPPER    351 - 420
VEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAIT    421 - 490
DIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCN    491 - 560
PSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKN    561 - 630
LDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPP    631 - 700
LQPQVYAG                                                                  701 - 708
//

Text Mined References (43)

PMID Year Title
26430212 2015 Rabaptin5 is recruited to endosomes by Rab4 and Rabex5 to regulate endosome maturation.
26002576 2015 Elevated RABEX-5 protein expression predicts poor prognosis in combined small cell lung cancer.
25427001 2014 RABEX-5 is upregulated and plays an oncogenic role in gastric cancer development by activating the VEGF signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24957337 2014 Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5.
24716822 2014 Expression of RABEX-5 and its clinical significance in prostate cancer.
24714377 2014 Rap1 signaling in endothelial barrier control.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382462 2013 RabGEFs are a major determinant for specific Rab membrane targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...