Property Summary

NCBI Gene PubMed Count 38
PubMed Score 21.40
PubTator Score 53.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 2.1

Expression

Gene RIF (20)

AA Sequence

MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQERCAEFPALRGPPTQGACSSCVQ      1 - 70
RGPVLCHRAPPGAAGEHAATEGREGAPSVSGTHALLQRPLGADCGDRPAACGPAEGPLCQAQVVSRKKMS     71 - 140
LKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERVLLCCPGWSAMV    141 - 210
QFQLTATSASWAQVILLLQPPKWLGLQKLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVK    211 - 280
KFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRD    281 - 350
LSIEEQSECAQDFYHNVAERMQTRGKERRFHHVGQAGLELLTSGDPPASASQSAGNTGVEPPHPAVPPER    351 - 420
VEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAIT    421 - 490
DIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCN    491 - 560
PSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKN    561 - 630
LDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPP    631 - 700
LQPQVYAG                                                                  701 - 708
//

Text Mined References (46)

PMID Year Title