Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.46
PubTator Score 9.48

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.800 0.000
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.200 0.041
juvenile dermatomyositis -1.047 0.000
adult high grade glioma -1.800 0.000
inflammatory breast cancer -1.400 0.003
lung carcinoma 1.600 0.000
Pick disease -1.300 0.000
ovarian cancer -1.100 0.000


Accession Q9UJ14 Q8N899 Q8NF66 Q9BYP5 Q9BYP6 GGT 7
Symbols GGT4


PANTHER Protein Class (2)

Gene RIF (3)

25884624 Our study demonstrates that GGT7 is a novel player in GBM growth and that GGT7 can play a critical role in tumorigenesis by regulating anti-oxidative damage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12270127 GGTL3 protein interacts with CT120, a plasma membrane-associated protein possibly involved in lung carcinogenesis.

AA Sequence

VLSWVHGSRRTNNFIIAVKDPRSPDAAGATIL                                          631 - 662

Text Mined References (14)

PMID Year Title
25884624 2015 ?-Glutamyl transferase 7 is a novel regulator of glioblastoma growth.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18357469 2008 The human gamma-glutamyltransferase gene family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12562771 2003 Identification and characterization of ADAMTS-20 defines a novel subfamily of metalloproteinases-disintegrins with multiple thrombospondin-1 repeats and a unique GON domain.