Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.45
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.800 4.8e-05
atypical teratoid / rhabdoid tumor -1.800 2.6e-07
ependymoma -1.200 5.6e-05
glioblastoma -1.800 8.1e-05
group 4 medulloblastoma -1.600 3.7e-04
inflammatory breast cancer -1.400 3.5e-03
juvenile dermatomyositis -1.047 3.7e-11
lung carcinoma 1.600 5.2e-30
medulloblastoma, large-cell -2.000 1.8e-05
ovarian cancer -1.100 2.3e-04
Pick disease -1.300 1.3e-06
primitive neuroectodermal tumor -1.200 4.1e-02

Gene RIF (3)

AA Sequence

MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDSFLKSARLQRL      1 - 70
PSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATGVTVALVMQIYFGDPQIFQQG     71 - 140
AVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAP    141 - 210
GALREETLQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQL    211 - 280
PPNMSERFRETFLPSGRPPLPGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEED    281 - 350
FSNYSALVEKPVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS    351 - 420
RLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVS    421 - 490
SLNQPFGSGLITPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLA    491 - 560
LGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDLQSNLLQVDSEFTEEEIEFLEARGHHVEKVD    561 - 630
VLSWVHGSRRTNNFIIAVKDPRSPDAAGATIL                                          631 - 662
//

Text Mined References (15)

PMID Year Title