Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.015 0.001
astrocytic glioma -1.500 0.010
ependymoma -1.500 0.020
psoriasis 1.600 0.000
glioblastoma -1.700 0.031
oligodendroglioma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.900 0.000
Amyotrophic Lateral Sclerosis 1.035 0.000
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.679 0.013
lung carcinoma 1.600 0.000
ovarian cancer -1.900 0.000
chronic rhinosinusitis -1.074 0.016

Synonym

Accession Q9UJ04 B4DYQ2 O94828 Q96GW8 TSPY-like protein 4
Symbols dJ486I3.2

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSGLDGGNKLPLAQTGGLAAPDHASGDPDRDQCQGLREETEATQVMANTGGGSLETVAEGGASQDPVDCG      1 - 70
PALRVPVAGSRGGAATKAGQEDAPPSTKGLEAASAAEAADSSQKNGCQLGEPRGPAGQKALEACGAGGLG     71 - 140
SQMIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAI    141 - 210
DQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMI    211 - 280
NLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNT    281 - 350
IPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG          351 - 414
//

Publication (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.