Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 2.1e-04
Amyotrophic lateral sclerosis 1.035 1.1e-05
astrocytic glioma -1.500 1.0e-02
atypical teratoid / rhabdoid tumor -1.700 1.2e-05
chronic rhinosinusitis -1.074 1.6e-02
ependymoma -1.500 2.0e-02
glioblastoma -1.300 1.4e-06
lung carcinoma 1.600 1.3e-32
medulloblastoma, large-cell -1.900 1.1e-06
Multiple myeloma 1.015 1.2e-03
oligodendroglioma -1.100 3.9e-14
ovarian cancer -1.900 2.6e-05
psoriasis 1.600 3.9e-04
subependymal giant cell astrocytoma -1.679 1.3e-02

Synonym

Accession Q9UJ04 B4DYQ2 O94828 Q96GW8 TSPY-like protein 4
Symbols dJ486I3.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MSGLDGGNKLPLAQTGGLAAPDHASGDPDRDQCQGLREETEATQVMANTGGGSLETVAEGGASQDPVDCG      1 - 70
PALRVPVAGSRGGAATKAGQEDAPPSTKGLEAASAAEAADSSQKNGCQLGEPRGPAGQKALEACGAGGLG     71 - 140
SQMIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAI    141 - 210
DQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMI    211 - 280
NLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNT    281 - 350
IPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG          351 - 414
//

Text Mined References (8)

PMID Year Title