Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.08
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.2e-06
medulloblastoma, large-cell 6241 3.4e-06
lung cancer 4740 1.1e-03
glioblastoma 5792 1.6e-03
Pick disease 1894 3.6e-03
active Crohn's disease 922 2.1e-02
Disease Target Count
Immunodeficiency 23 3

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.005 2.1e-02
glioblastoma -1.100 1.6e-03
lung cancer 1.800 1.1e-03
medulloblastoma, large-cell -1.700 3.4e-06
ovarian cancer -1.500 2.2e-06
Pick disease -1.100 3.6e-03

Synonym

Accession Q9UIY3 B4DIQ3 E1P548 Q2M3R3 Q96FH1
Symbols RWDD2
dJ747H23.2

Gene

PANTHER Protein Class (2)

PDB

2DAW  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MSASVKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKI      1 - 70
DLQVTMPHSYPYVALQLFGRSSELDRHQQLLLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKL     71 - 140
VYEPSTQAKPVKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCMTGKPGIICVEGFKEHCEEFWHT    141 - 210
IRYPNWKHISCKHAESVETEGNGEDLRLFHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQ    211 - 280
ILFGIESKSSDS                                                              281 - 292
//

Text Mined References (7)

PMID Year Title