Property Summary

Ligand Count 3
NCBI Gene PubMed Count 11
PubMed Score 59.29
PubTator Score 27.91

Knowledge Summary

Patent (6,549)

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.003 2.0e-02
adult high grade glioma -1.800 2.5e-03
Astrocytoma, Pilocytic -2.100 5.0e-06
glioblastoma -1.500 6.2e-04
group 4 medulloblastoma -2.100 5.1e-04
malignant mesothelioma 2.000 3.6e-07
medulloblastoma, large-cell -2.000 6.0e-04
non-small cell lung cancer 1.271 1.2e-06
osteosarcoma 1.045 7.4e-03
primitive neuroectodermal tumor -1.200 2.3e-02
ulcerative colitis -1.100 2.2e-06
X-linked cerebral adrenoleukodystrophy 1.500 1.0e-02

Gene RIF (2)

AA Sequence

MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPEDRRRRIIINVG      1 - 70
GIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLR     71 - 140
EMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMVEREEEDDALDSEGRDSEGPAEGEGRLGRCM    141 - 210
RRLRDMVERPHSGLPGKVFACLSVLFVTVTAVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFS    211 - 280
LEFLLRLIQAPSKFAFLRSPLTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRI    281 - 350
LYVMRLARHSLGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI    351 - 420
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFRRAQFLIKTKS    421 - 490
QLSVSQDSDILFGSASSDTRDNN                                                   491 - 513
//

Text Mined References (12)

PMID Year Title