Property Summary

NCBI Gene PubMed Count 10
Grant Count 25
R01 Count 20
Funding $3,138,666.8
PubMed Score 13.43
PubTator Score 5.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.100 0.000
glioblastoma 1.100 0.000
group 4 medulloblastoma 2.300 0.000
medulloblastoma, large-cell 1.200 0.010
primitive neuroectodermal tumor 2.000 0.002
pilocytic astrocytoma 1.300 0.000
ovarian cancer 1.100 0.000

Gene RIF (4)

PMID Text
23322567 A susceptibility locus was identified with lead single nucleotide polymorphism rs3771395 on chromosome 2p13.3 (meta-analysis, P = 1.97 x 10(-7)) in the VAX2 gene for astigmatism.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16953426 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGP      1 - 70
GEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLN     71 - 140
LSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSLLALTPSLPGL    141 - 210
PASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVG    211 - 280
SASSCKKANT                                                                281 - 290
//

Text Mined References (11)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23322567 2013 Identification of a candidate gene for astigmatism.
22095910 2012 VAX1 mutation associated with microphthalmia, corpus callosum agenesis, and orofacial clefting: the first description of a VAX1 phenotype in humans.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17963489 2007 Classification and nomenclature of all human homeobox genes.
16953426 2006 Analysis of candidate genes on chromosome 2 in oral cleft case-parent trios from three populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...