Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.44
PubTator Score 5.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 9.1e-07
glioblastoma 1.100 1.7e-04
group 3 medulloblastoma 1.800 8.0e-04
medulloblastoma, large-cell 1.200 1.0e-02
oligodendroglioma 1.100 2.6e-10
ovarian cancer 1.100 1.7e-08
primitive neuroectodermal tumor 2.000 2.2e-03

Gene RIF (5)

AA Sequence

MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGP      1 - 70
GEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLN     71 - 140
LSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNILRLLEQGRLLSVPRAPSLLALTPSLPGL    141 - 210
PASHRGTSLGDPRNSSPRLNPLSSASASPPLPPPLPAVCFSSAPLLDLPAGYELGSSAFEPYSWLERKVG    211 - 280
SASSCKKANT                                                                281 - 290
//

Text Mined References (12)

PMID Year Title