Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.57
PubTator Score 19.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 1.900 7.3e-04
cutaneous lupus erythematosus 2.000 3.0e-03
cystic fibrosis and chronic rhinosinusit... 1.164 4.1e-02
esophageal adenocarcinoma -2.800 2.4e-02
interstitial cystitis 2.000 3.0e-02
nasopharyngeal carcinoma -2.900 2.6e-04
non-small cell lung cancer 2.583 4.5e-09
osteosarcoma -1.092 3.7e-04
psoriasis 2.700 2.3e-09
spina bifida -2.855 3.7e-02

Gene RIF (9)

AA Sequence

MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKA      1 - 70
EEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA     71 - 140
ADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKS    141 - 210
VQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERK    211 - 280
VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATG    281 - 350
IGFTVTSAPGHENVHCNHPFLFFIRHNESNSILFFGRFSSP                                 351 - 391
//

Text Mined References (21)

PMID Year Title