Property Summary

NCBI Gene PubMed Count 59
PubMed Score 171.12
PubTator Score 65.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.1e-10
osteosarcoma 7950 2.4e-07
ependymoma 4679 3.1e-02
lung cancer 4740 3.7e-02
spina bifida 1074 3.9e-02
subependymal giant cell astrocytoma 2287 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Trigeminal Neuralgia 24 6.071 3.0
Leprosy 73 4.285 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 3.1e-02
lung cancer 1.200 3.7e-02
osteosarcoma -1.760 2.4e-07
ovarian cancer -1.200 1.1e-10
spina bifida -1.025 3.9e-02
subependymal giant cell astrocytoma -1.120 4.2e-02

Gene RIF (36)

AA Sequence

MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILC      1 - 70
YPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISF     71 - 140
SGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKC    141 - 210
ERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAA    211 - 280
RRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDC    281 - 350
GRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPT    351 - 420
LKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLS    421 - 490
WVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLA    491 - 560
PEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ                             561 - 605
//

Text Mined References (70)

PMID Year Title