Property Summary

NCBI Gene PubMed Count 55
Grant Count 41
R01 Count 26
Funding $2,792,933.94
PubMed Score 164.65
PubTator Score 65.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 0.031
osteosarcoma -1.806 0.000
lung cancer 1.200 0.037
subependymal giant cell astrocytoma -1.120 0.042
spina bifida -1.025 0.039
ovarian cancer 1.400 0.000

Gene RIF (32)

PMID Text
25798578 MBD1 targets short interspersed nuclear elements, but does not exclude RNA Polymerase III.
25658035 Molecular dynamic simulation reveals mechanism of the recognition of dimethylated CpG sites by MBD1 protein.
24849540 This study investigates the genetic association between methyl-CpG-binding domain (MBD) gene polymorphisms and schizophrenia.
24464130 We demonstrated the importance of Aire's interaction with the ATF7ip-MBD1 protein complex in maintaining central tolerance
23588667 an important function of MBD1 in DNA repair and mediation of chemoradioresistance of cancer cells
23331011 higher MBD1 expression correlated with lymph node metastasis and poor survival in pancreatic cancer; gain- and loss-of-function studies in vitro validated MBD1 as a potent oncogene promoting pancreatic cancer cell invasion and epithelial-mesenchymal transition
21491466 MBD1-containing chromatin associated factor 2, epithelial malignancy-related vimentin and exocytosis-related annexin A2 were changed upon exposure to airborne nanoparticle PM(0.056).
21326358 This review tries to match MeCP2 structural domains, or their lack, and specific chromatin features needed for proper recruitment of MeCP2 to its functions as either activator or repressor. We specifically focused on MeCP2's role in Rett syndrome
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18668384 Results suggest that MBD1 polymorphisms might be involved in the development of lung cancer in Chinese population.
More...

AA Sequence

MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILC      1 - 70
YPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISF     71 - 140
SGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKC    141 - 210
ERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAA    211 - 280
RRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDC    281 - 350
GRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPT    351 - 420
LKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLS    421 - 490
WVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLA    491 - 560
PEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ                             561 - 605
//

Publication (65)

PMID Year Title
25798578 2015 SINE transcription by RNA polymerase III is suppressed by histone methylation but not by DNA methylation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25658035 2015 Molecular dynamics study of the recognition of dimethylated CpG sites by MBD1 protein.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24849540 2014 Genetic association study between methyl-CpG-binding domain genes and schizophrenia among Chinese family trios.
24464130 2014 The transcriptional regulator Aire coopts the repressive ATF7ip-MBD1 complex for the induction of immunotolerance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23588667 2013 Silencing of MBD1 reverses pancreatic cancer therapy resistance through inhibition of DNA damage repair.
More...