Property Summary

NCBI Gene PubMed Count 77
Grant Count 20
R01 Count 9
Funding $4,143,792.62
PubMed Score 348.28
PubTator Score 114.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
ovarian cancer 1.200 0.000

Gene RIF (65)

PMID Text
26679868 BTNL2 may have an inhibitory effect on FOXP3(+) T cell proliferation, especially in patients homozygous for the risk alleles.
26617759 genetic mutations within or around BTNL2 (rs3763313, rs9268494, rs9268492 and rs9268402) could alter susceptibility to grade IV of dilated cardiomyopathy in a Chinese population
25849037 BTNL2 rs2076530 polymorphism contributes to the risk of sarcoidosis
25671699 The association of the rare variant p.G454C in BTNL2 reached genome-wide significance, and was independent of the known common risk variants for IBD in the HLA region in both a conditional and haplotype analysis
25569183 Two independent loci near BTNL2 (rs9461741) and HLA-B (rs2922994) in the HLA region significantly associated with Marginal Zone B-Cell Lymphoma risk.
25551927 No variation except in the 329-bp region containing the BTNL2 rs2076530 polymorphism was found in Turkish patients with sarcoidosis.
25078641 Results confirm the association of BTNL2 rs2076530SNP with the susceptibility to develop sarcoidosis, but not with an increased risk of cancer in these patients.
24664813 These findings suggest that polymorphisms in the BTNL2 gene might play a vital role in determining the outcome of the immune response to hepatitis B vaccination.
23904553 the BTNL2 splice site polymorphism (A variant of rs2076530) shows association with an increased risk for persistent sarcoidosis
23833122 Rare BTNL2 variants play a role in susceptibility to both familial and sporadic prostate cancer. Results implicate BTNL2 as a novel prostate cancer susceptibility gene.
More...

AA Sequence

MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEP      1 - 70
STPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLK     71 - 140
VAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRN    141 - 210
ASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEV    211 - 280
RWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQ    281 - 350
EASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQ    351 - 420
TLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW                                       421 - 455
//

Publication (79)

PMID Year Title
26679868 2016 Novel 6p21.3 Risk Haplotype Predisposes to Acute Coronary Syndrome.
26617759 2015 Association of genetic polymorphisms on BTNL2 with susceptibility to and prognosis of dilated cardiomyopathy in a Chinese population.
25849037 2015 BTNL2 gene polymorphism and sarcoidosis susceptibility: a meta-analysis.
25671699 2015 Pooled sequencing of 531 genes in inflammatory bowel disease identifies an associated rare variant in BTNL2 and implicates other immune related genes.
25569183 2015 A genome-wide association study of marginal zone lymphoma shows association to the HLA region.
25551927 2014 Is there a genetic predisposition for Turkish patients with sarcoidosis in the 329-bp region containing the BTNL2 rs2076530 polymorphism?
25078641 2014 Lack of correlation of BTNL2 polymorphism and cancer risk in sarcoidosis. BTNL2 and cancer risk in sarcoidosis.
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24943344 2014 Frontotemporal dementia and its subtypes: a genome-wide association study.
24664813 2014 BTNL2 associated with the immune response to hepatitis B vaccination in a Chinese Han population.
More...