Property Summary

NCBI Gene PubMed Count 89
PubMed Score 369.25
PubTator Score 114.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
sarcoidosis 370 5.316 2.7
Berylliosis 28 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 5.3e-11
medulloblastoma, large-cell 6241 4.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 4.0e-04
ovarian cancer 1.200 5.3e-11

Gene RIF (70)

AA Sequence

MVDFPGYNLSGAVASFLFILLTMKQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEP      1 - 70
STPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLK     71 - 140
VAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRN    141 - 210
ASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEV    211 - 280
RWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQ    281 - 350
EASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQ    351 - 420
TLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW                                       421 - 455
//

Text Mined References (91)

PMID Year Title