Property Summary

NCBI Gene PubMed Count 18
PubMed Score 26.70
PubTator Score 33.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
malignant mesothelioma 3163 5.0e-06
osteosarcoma 7933 4.7e-05
group 3 medulloblastoma 2254 6.2e-04
psoriasis 6685 6.7e-04
Disease Target Count Z-score Confidence
Vitiligo 71 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 5.0e-06
psoriasis 1.300 6.7e-04
osteosarcoma -1.650 4.7e-05
group 3 medulloblastoma 1.100 6.2e-04

Synonym

Accession Q9UIM3 A8K5V3 B0UYX8 Q9H5G3
Symbols NG7
DIR1
FKBP4
WISP39

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
25906750 The data suggests a role for FKBPL as a prognostic factor for BCSS, with the potential to be routinely evaluated within the clinic.
25800056 WISp39 preferentially interacts with phosphorylated Coronin 1B, allowing it to complex with Slingshot phosphatase to dephosphorylate and activate Cofilin.
25767277 FKBPL is an important regulator of developmental and pathological angiogenesis.
23912458 high levels of FKBPL and RBCK1 correlated with increased patient survival, whereas high RBCK1 predicted for a poor response to tamoxifen.
23457460 FKBPL and and its peptide derivative, AD-01 regulate expression of CD44.
22694956 Genome-wide association study of age-related macular degeneration identifies TNXB, FKBPL and NOTCH4 as candidate susceptibility genes.
20210997 Alterations in the gene for FKBPL in azoospermic patients.
20210997 Observational study of gene-disease association. (HuGE Navigator)
20103631 Findings suggest that FKBPL may have prognostic value based on its impact on tumor proliferative capacity and sensitivity to endocrine therapies, which improve outcome.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18669603 FKBPL can be classed as a new member of the FKBP protein family with a role in steroid receptor complexes and signaling.
15664193 Results demonstrate the importance of posttranslational stabilization of p21 protein by WISp39 in regulating cellular p21 activity.

AA Sequence

METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV      1 - 70
AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG     71 - 140
WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA    141 - 210
REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE    211 - 280
REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG     281 - 349
//

Text Mined References (23)

PMID Year Title
25906750 2015 FKBPL: a marker of good prognosis in breast cancer.
25800056 2015 WISp39 binds phosphorylated Coronin 1B to regulate Arp2/3 localization and Cofilin-dependent motility.
25767277 2015 FKBPL is a critical antiangiogenic regulator of developmental and pathological angiogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23912458 2014 Identification of RBCK1 as a novel regulator of FKBPL: implications for tumor growth and response to tamoxifen.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23457460 2013 The anti-migratory effects of FKBPL and its peptide derivative, AD-01: regulation of CD44 and the cytoskeletal pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22694956 2012 Genome-wide association study of age-related macular degeneration identifies associated variants in the TNXB-FKBPL-NOTCH4 region of chromosome 6p21.3.
20210997 2010 Alterations in the steroid hormone receptor co-chaperone FKBPL are associated with male infertility: a case-control study.
20103631 2010 FKBPL regulates estrogen receptor signaling and determines response to endocrine therapy.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18669603 2008 A novel FK506-like binding protein interacts with the glucocorticoid receptor and regulates steroid receptor signaling.
15664193 2005 Regulation of p21(WAF1/CIP1) stability by WISp39, a Hsp90 binding TPR protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10866283 2000 Increased repair and cell survival in cells treated with DIR1 antisense oligonucleotides: implications for induced radioresistance.
10521921 1999 A novel human stress response-related gene with a potential role in induced radioresistance.
9056895 1997 Gene regulation by low-dose ionizing radiation in a normal human lung epithelial cell line.