Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 9
Funding $332,294.54
PubMed Score 26.70
PubTator Score 33.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.300 0.001
osteosarcoma -1.650 0.000
group 3 medulloblastoma 1.100 0.001

Gene RIF (12)

PMID Text
25906750 The data suggests a role for FKBPL as a prognostic factor for BCSS, with the potential to be routinely evaluated within the clinic.
25800056 WISp39 preferentially interacts with phosphorylated Coronin 1B, allowing it to complex with Slingshot phosphatase to dephosphorylate and activate Cofilin.
25767277 FKBPL is an important regulator of developmental and pathological angiogenesis.
23912458 high levels of FKBPL and RBCK1 correlated with increased patient survival, whereas high RBCK1 predicted for a poor response to tamoxifen.
23457460 FKBPL and and its peptide derivative, AD-01 regulate expression of CD44.
22694956 Genome-wide association study of age-related macular degeneration identifies TNXB, FKBPL and NOTCH4 as candidate susceptibility genes.
20210997 Alterations in the gene for FKBPL in azoospermic patients.
20210997 Observational study of gene-disease association. (HuGE Navigator)
20103631 Findings suggest that FKBPL may have prognostic value based on its impact on tumor proliferative capacity and sensitivity to endocrine therapies, which improve outcome.
19851445 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV      1 - 70
AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG     71 - 140
WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA    141 - 210
REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE    211 - 280
REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG     281 - 349
//

Publication (23)

PMID Year Title
25906750 2015 FKBPL: a marker of good prognosis in breast cancer.
25800056 2015 WISp39 binds phosphorylated Coronin 1B to regulate Arp2/3 localization and Cofilin-dependent motility.
25767277 2015 FKBPL is a critical antiangiogenic regulator of developmental and pathological angiogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23912458 2014 Identification of RBCK1 as a novel regulator of FKBPL: implications for tumor growth and response to tamoxifen.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23457460 2013 The anti-migratory effects of FKBPL and its peptide derivative, AD-01: regulation of CD44 and the cytoskeletal pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22694956 2012 Genome-wide association study of age-related macular degeneration identifies associated variants in the TNXB-FKBPL-NOTCH4 region of chromosome 6p21.3.
More...