Property Summary

NCBI Gene PubMed Count 31
Grant Count 3
Funding $363,881
PubMed Score 17.00
PubTator Score 39.71

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
21320718 the single nucleotide polymorphism rs1046295 of PHF11 modulates allele-specific binding by the octamer-binding transcription factor 1
20717939 PHF11 (PHD finger protein 11) is not a major candidate gene for asthma or eczema in Chinese children
20717939 Observational study of gene-disease association. (HuGE Navigator)
20716621 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20421878 contributes to T-cell activation and viability
20085599 We were unable to confirm associations of single nucleotide polymorphisms of the positional candidates DPP10 and PHF11 with wheeze. Significant associations with reported and examined eczema were only observed for DPP10.
20085599 Observational study of gene-disease association. (HuGE Navigator)
19996348 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFAQSENIAAHEN      1 - 70
CLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDD     71 - 140
AVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGR    141 - 210
HTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQA    211 - 280
AIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY                       281 - 331
//

Text Mined References (31)

PMID Year Title
26573531 2015 PHF11 expression and cellular distribution is regulated by the Toll-Like Receptor 3 Ligand Polyinosinic:Polycytidylic Acid in HaCaT keratinocytes.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21320718 2011 Allele-specific transcription of the asthma-associated PHD finger protein 11 gene (PHF11) modulated by octamer-binding transcription factor 1 (Oct-1).
20717939 2010 PHF11 is not a major candidate gene for asthma or eczema in Chinese children.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20627928 2010 Association of PHF11 polymorphisms with asthma and allergy.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20421878 A role for the atopy-associated gene PHF11 in T-cell activation and viability.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
More...