Property Summary

NCBI Gene PubMed Count 31
PubMed Score 17.00
PubTator Score 39.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.048 2.2e-05
adrenocortical carcinoma -1.035 4.6e-04
Astrocytoma, Pilocytic 1.200 4.5e-07
dermatomyositis 1.300 7.8e-03
group 3 medulloblastoma -1.300 7.6e-03
juvenile dermatomyositis 2.011 2.9e-19
lung cancer -1.200 2.5e-03
malignant mesothelioma -1.600 3.9e-06
medulloblastoma, large-cell -2.700 3.4e-06
non-small cell lung cancer -1.095 3.7e-17
osteosarcoma -1.672 8.6e-04
ovarian cancer -1.500 8.1e-07
pancreatic ductal adenocarcinoma liver m... 1.540 2.3e-02
posterior fossa group B ependymoma 1.100 1.8e-05
subependymal giant cell astrocytoma 1.473 6.0e-03

Gene RIF (26)

AA Sequence

MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFAQSENIAAHEN      1 - 70
CLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDD     71 - 140
AVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGR    141 - 210
HTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQA    211 - 280
AIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY                       281 - 331
//

Text Mined References (31)

PMID Year Title