Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.59
PubTator Score 2.29

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 3.1e-02
fibroadenoma 559 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9


  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.400 3.1e-02
fibroadenoma -2.400 3.6e-02

Gene RIF (1)

AA Sequence

LQGLGFGIRARQVQRGPARKKPPSSQTEGKRRPD                                        351 - 384

Text Mined References (9)

PMID Year Title