Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $52,190
PubMed Score 2.25
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
fibroadenoma 557

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.400 0.031
fibroadenoma -2.400 0.036

AA Sequence

MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLTSLLDGYNVCVMAYGQTGSG      1 - 70
KSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFRLILENTSRSPKVEVSIVEVYNNDIFDLLAKDSIA     71 - 140
AVSGVKREVVTAKDGRTEVALLASEAVGSASKLMELVHGGLQLRAKHPTLVHADSSRSHLIITVTLTTAS    141 - 210
CSDSTADQACSATLPREQTEAGRAGRSRRASQGALAPQLVPGNPAGHAEQVQARLQLVDSAGSECVGVSG    211 - 280
VTGLALREMACISRSLAALAGVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQT    281 - 350
LQGLGFGIRARQVQRGPARKKPPSSQTEGKRRPD                                        351 - 384
//

Text Mined References (7)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416179 2001 All kinesin superfamily protein, KIF, genes in mouse and human.
9925916 1998 Identification, genomic organization, and alternative splicing of KNSL3, a novel human gene encoding a kinesin-like protein.
9925910 1998 Assignment1 of CSRP1 encoding the LIM domain protein CRP1, to human chromosome 1q32 by fluorescence in situ hybridization.