Property Summary

NCBI Gene PubMed Count 52
Grant Count 19
R01 Count 8
Funding $1,577,035.4
PubMed Score 81.24
PubTator Score 169.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.400 0.000
posterior fossa group B ependymoma -4.700 0.000
oligodendroglioma -1.300 0.030
glioblastoma -3.200 0.003
group 4 medulloblastoma -3.900 0.000
cystic fibrosis 1.749 0.000
atypical teratoid / rhabdoid tumor -3.500 0.001
medulloblastoma, large-cell -2.900 0.001
pediatric high grade glioma -2.600 0.001
Pick disease -1.700 0.005

Gene RIF (28)

PMID Text
26402097 Results suggest that TMEFF2 is a brain-enriched endogenous modulator of Abeta neurotoxicity and an enhancer of alpha-secretase processing of AbetaPP
25573902 TMEFF2 regulates the non-canonical activin/BMP4 signaling, PI3K, and Ras/ERK1/2 pathways.
24987055 TMEFF2 acts as a tumor suppressor in gastric cancer through direct interaction with SHP-1 and can be a potential biomarker of carcinogenesis.
24919179 c-Myc contributes to the epigenetic regulation of HPP1 via the dominant recruitment of HDAC3.
23824605 TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells.
23405127 Androgen signaling promotes eIF2alpha phosphorylation and subsequent translation of TMEFF2 via a mechanism that requires uORFs in the 5'-UTR of TMEFF2.
22814847 Findings suggest that methylation-associated down-regulation of TMEFF2 gene may be involved in lung tumorigenesis and TMEFF2 methylation can serve as a specific blood-based biomarker for NSCLC.
22532293 Methylation of TMEFF2 gene is associated with colorectal neoplasia in ulcerative colitis and Crohn's colitis.
22238370 Several genes expressed at exceptionally high levels were identified associated with early oocyte development, TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1) and the mitochondrial-encoded ATPase6 (ATP6).
21559523 TMEFF2 can function to regulate PDGF signaling; it is hypermethylated and downregulated in glioma and several other cancers
More...

AA Sequence

MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYDDRENDLFLCD      1 - 70
TNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAG     71 - 140
SGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKE    141 - 210
ASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEH    211 - 280
SINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNR    281 - 350
IHRQKQNTGHYSSDNTTRASTRLI                                                  351 - 374
//

Text Mined References (55)

PMID Year Title
26402097 2015 Tomoregulin (TMEFF2) Binds Alzheimer's Disease Amyloid-? (A?) Oligomer and A?PP and Protects Neurons from A?-Induced Toxicity.
25644509 2015 Four DNA methylation biomarkers in biliary brush samples accurately identify the presence of cholangiocarcinoma.
25573902 2015 TMEFF2 is an endogenous inhibitor of the CRH signal transduction pathway.
25123395 2014 Validation of DNA promoter hypermethylation biomarkers in breast cancer--a short report.
25042611 2014 The genetics of hemoglobin A2 regulation in sickle cell anemia.
24996057 2015 Bidirectional regulation between TMEFF2 and STAT3 may contribute to Helicobacter pylori-associated gastric carcinogenesis.
24987055 2014 TMEFF2 deregulation contributes to gastric carcinogenesis and indicates poor survival outcome.
24919179 2014 The interplay between histone deacetylases and c-Myc in the transcriptional suppression of HPP1 in colon cancer.
24632071 2014 The TMEFF2 tumor suppressor modulates integrin expression, RhoA activation and migration of prostate cancer cells.
24100025 2014 Accurate detection of upper tract urothelial carcinoma in tissue and urine by means of quantitative GDF15, TMEFF2 and VIM promoter methylation.
More...