Property Summary

NCBI Gene PubMed Count 28
Grant Count 196
R01 Count 139
Funding $17,249,556.39
PubMed Score 27.03
PubTator Score 29.12

Knowledge Summary

Patent (7,449)

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.180 0.000
non-small cell lung cancer -2.031 0.000
lung cancer -3.700 0.000
breast carcinoma -1.200 0.000
fibroadenoma -1.200 0.039
cystic fibrosis -1.200 0.000
lung adenocarcinoma -2.300 0.000
lung carcinoma -1.700 0.000
ductal carcinoma in situ -1.400 0.006
invasive ductal carcinoma -1.700 0.001
ulcerative colitis -1.200 0.000

Synonym

Accession Q9UIK4 E9JGM7 O75892 Q24JS1 DAP kinase 2
Symbols DRP1
DRP-1

Gene

PDB

1WMK   1WRZ   1Z9X   1ZUZ   1ZWS   2A27   2A2A   2CKE  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26483415 that Death-associated protein kinase 2 effector functions are influenced by the protein's subcellular localization
26047703 DAPK2-induced apoptosis is negatively regulated by Akt and 14-3-3 proteins.
26038578 This study links adipocyte expression of an autophagy-regulating kinase, lysosome-mediated clearance and fat cell lipid accumulation; it demonstrates obesity-related attenuated autophagy in adipocytes, and identifies DAPK2 dependence in this regulation.
25982274 miR-520h suppresses Death-associated protein kinase 2 (DAPK2) expression, as restoring DAPK2 abolished miR-520h-promoted drug resistance, and knockdown of DAPK2 mitigated cell death caused by the depletion of miR-520h.
25741596 DAPK2 regulates oxidative stress in cancer cells by preserving mitochondrial function
25361081 DAPK2 is a novel kinase of mTORC1 and is a potential new member of this multiprotein complex, modulating mTORC1 activity and autophagy levels under stress and steady-state conditions.
24163421 The defect in chemotaxis in DAPK2-inactive granulocytes is likely a result of reduced polarization of the cells, mediated by a lack of MLC phosphorylation, resulting in radial F-actin and pseudopod formation.
24038216 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL.
23700042 DAPK2 is upregulated in uterosacral ligaments in pelvic organ prolapse
22160140 Sodium butyrate induced DAPK1/2 expression in human gastric cancer cells and this expression prompted apoptosis by decreasing FAK levels.
More...

AA Sequence

MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREE      1 - 70
IEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYL     71 - 140
HTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADM    141 - 210
WSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEAL    211 - 280
RHPWITPVDNQQAMVRRESVVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESD    281 - 350
TEEDIARRKALHPRRRSSTS                                                      351 - 370
//

Text Mined References (33)

PMID Year Title
26483415 2016 Identification of Novel Death-Associated Protein Kinase 2 Interaction Partners by Proteomic Screening Coupled with Bimolecular Fluorescence Complementation.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
26038578 2015 DAPK2 Downregulation Associates With Attenuated Adipocyte Autophagic Clearance in Human Obesity.
25982274 2016 miR-520h is crucial for DAPK2 regulation and breast cancer progression.
25741596 2015 DAPK2 regulates oxidative stress in cancer cells by preserving mitochondrial function.
25416956 2014 A proteome-scale map of the human interactome network.
25361081 2015 DAPK2 is a novel regulator of mTORC1 activity and autophagy.
24163421 2014 DAPK2 positively regulates motility of neutrophils and eosinophils in response to intermediary chemoattractants.
24038216 2014 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBP? during granulocytic differentiation but repressed by PML-RAR? in APL.
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
More...