Property Summary

Ligand Count 3
NCBI Gene PubMed Count 30
PubMed Score 28.70
PubTator Score 29.12

Knowledge Summary

Patent (7,449)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Hepatomegaly 285 0.0 0.0

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -1.200 8.1e-05
cystic fibrosis -1.200 5.2e-05
ductal carcinoma in situ -1.400 5.6e-03
fibroadenoma -1.200 3.9e-02
invasive ductal carcinoma -1.700 1.4e-03
lung adenocarcinoma -1.200 3.1e-12
lung cancer -1.300 7.2e-04
lung carcinoma -1.700 3.1e-23
non-small cell lung cancer -1.381 1.8e-23
osteosarcoma -2.294 9.6e-07
ulcerative colitis -1.200 2.8e-06

Gene RIF (21)

AA Sequence

MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREE      1 - 70
IEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYL     71 - 140
HTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADM    141 - 210
WSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEAL    211 - 280
RHPWITPVDNQQAMVRRESVVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESD    281 - 350
TEEDIARRKALHPRRRSSTS                                                      351 - 370
//

Text Mined References (35)

PMID Year Title