Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
R01 Count 1
Funding $79,250
PubMed Score 22.03
PubTator Score 79.99

Knowledge Summary

Patent (7,325)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.490 0.001
pancreatic ductal adenocarcinoma liver m... -2.893 0.002
invasive ductal carcinoma -1.500 0.000
ulcerative colitis -1.200 0.000
ovarian cancer -2.100 0.000
pancreatic cancer 1.700 0.001

Synonym

Accession Q9UIJ7 B4DP58 D3DRI1 E7ET30 Q5VYW6 Q9H576 Q9HC01 Q9NPB4
Symbols AK6
FIX
AK3L1
AKL3L
AKL3L1

Gene

AK3

PANTHER Protein Class (3)

 Grant Application (1)

PDB

1ZD8  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDV      1 - 70
MTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNI     71 - 140
EFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYA    141 - 210
FLQTKVPQRSQKASVTP                                                         211 - 227
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...