Property Summary

NCBI Gene PubMed Count 16
PubMed Score 69.12
PubTator Score 37.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver neoplasms 109
Weight Gain 87
Disease Target Count P-value
lung carcinoma 2844 7.47387732270743E-22
non-small cell lung cancer 2798 3.07027654187267E-11
Breast cancer 3099 7.30305819824724E-11
ovarian cancer 8492 1.16199811774417E-5
tuberculosis 1563 1.46205575270531E-5
fascioscapulohumeral muscular dystrophy 100 8.98168175774545E-5
group 4 medulloblastoma 1875 1.29528908754393E-4
osteosarcoma 7933 1.53462339029243E-4
urothelial carcinoma 318 0.00343828445340873
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00554435008925362
adrenocortical carcinoma 1427 0.008047753925819
invasive ductal carcinoma 2950 0.0188931409610548
spina bifida 1064 0.0453193782314629
Disease Target Count Z-score Confidence
locked-in syndrome 10 4.001 2.0
interstitial cystitis 2299 3.162 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma -2.400 0.003
osteosarcoma -2.561 0.000
group 4 medulloblastoma -2.100 0.000
fascioscapulohumeral muscular dystrophy 1.020 0.000
adrenocortical carcinoma -1.733 0.008
tuberculosis 1.300 0.000
non-small cell lung cancer -1.227 0.000
intraductal papillary-mucinous neoplasm ... -1.600 0.006
interstitial cystitis -1.500 0.000
lung carcinoma 1.100 0.000
spina bifida 1.035 0.045
Breast cancer -2.900 0.000
invasive ductal carcinoma -1.300 0.019
ovarian cancer -2.500 0.000

Synonym

Accession Q9UIJ5 D3DSP5
Symbols DHHC2
ZNF372

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (9)

PMID Text
24995331 These results suggest an important role for ZDHHC2 as a tumor suppressor in metastasis and recurrence of HCC.
23457560 reduced ZDHHC2 expression is associated with lymph node metastasis and independently predicts an unfavorable prognosis in gastric adenocarcinoma patients
22034844 DHHC2 localizes primarily to the endoplasmic reticulum and Golgi apparatus suggesting that it is involved in S-acylation of newly-synthesized or recycling Lck involved in T cell signalling.
21471008 The palmitoyl transferase DHHC2 targets a dynamic membrane cycling pathway: regulation by a C-terminal domain
21343290 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144824 DHHC2-mediated palmitoylation of CKAP4 has a role in opposing cancer-related cellular behaviors.
18508921 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151
18296695 Identification of CKAP4/p63 as a substrate of DHHC2, a putative tumor suppressor.

AA Sequence

MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY      1 - 70
WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC     71 - 140
HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH    141 - 210
IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL    211 - 280
LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG    281 - 350
KCKAGMSNPALTMENET                                                         351 - 367
//

Text Mined References (17)

PMID Year Title
24995331 2014 A critical role for ZDHHC2 in metastasis and recurrence in human hepatocellular carcinoma.
23457560 2013 Reduced expression of ZDHHC2 is associated with lymph node metastasis and poor prognosis in gastric adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22034844 DHHC2 is a protein S-acyltransferase for Lck.
21471008 2011 The palmitoyl transferase DHHC2 targets a dynamic membrane cycling pathway: regulation by a C-terminal domain.
21343290 2011 Gi/o signaling and the palmitoyltransferase DHHC2 regulate palmitate cycling and shuttling of RGS7 family-binding protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19144824 2009 Palmitoylation of cytoskeleton associated protein 4 by DHHC2 regulates antiproliferative factor-mediated signaling.
18508921 2008 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151.
More...