Property Summary

NCBI Gene PubMed Count 16
PubMed Score 79.65
PubTator Score 37.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial cystitis -1.100 2.9e-03
adrenocortical carcinoma -1.175 4.3e-02
Breast cancer -2.900 7.3e-11
fascioscapulohumeral muscular dystrophy 1.020 9.0e-05
group 4 medulloblastoma -1.200 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 5.5e-03
invasive ductal carcinoma -1.300 1.9e-02
lung carcinoma 1.100 7.5e-22
non-small cell lung cancer -1.227 3.1e-11
osteosarcoma -1.161 6.6e-06
ovarian cancer -2.500 1.2e-05
spina bifida 1.035 4.5e-02
tuberculosis 1.200 2.1e-07
urothelial carcinoma -2.100 7.7e-03

Gene RIF (9)

AA Sequence

MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY      1 - 70
WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC     71 - 140
HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH    141 - 210
IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL    211 - 280
LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG    281 - 350
KCKAGMSNPALTMENET                                                         351 - 367
//

Text Mined References (17)

PMID Year Title