Property Summary

NCBI Gene PubMed Count 14
PubMed Score 29.87
PubTator Score 10.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Vaccinia 37 3.655 1.8

Gene RIF (4)

PMID Text
21360282 data suggest an important role for DUSP13B in protection from external stress during spermatogenesis
17044055 Here, we report the crystal structure of human TMDP at a resolution of 2.4 A. In spite of high sequence similarity with other DSPs, the crystal structure of TMDP shows distinct structural motifs and surface propertie
16385451 Observational study of gene-disease association. (HuGE Navigator)
15252030 identified a gene on chromosome 10q22.2 using alternative ORFs to encode two distinct DSPs: the testis and skeletal muscle-specific TMDP and a novel muscle-restricted DSP(MDSP)

AA Sequence

MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQL      1 - 70
GITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAM     71 - 140
GVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF                141 - 198
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
21360282 2011 DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression.
17044055 2007 Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252030 2004 Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2.
More...