Property Summary

NCBI Gene PubMed Count 14
PubMed Score 34.38
PubTator Score 10.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (4)

AA Sequence

MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQL      1 - 70
GITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAM     71 - 140
GVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF                141 - 198
//

Text Mined References (14)

PMID Year Title