Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.35
PubTator Score 6.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.12575042783069E-13
astrocytoma 1493 1.46994785437839E-13
glioblastoma 5572 8.65577634370884E-10
psoriasis 6685 8.52765643145727E-9
osteosarcoma 7933 6.67892169231034E-7
pediatric high grade glioma 2712 3.34503088647493E-6
sonic hedgehog group medulloblastoma 1482 1.73559730629434E-5
pilocytic astrocytoma 3086 5.17314809492309E-4
lung cancer 4473 9.28712878806092E-4
cystic fibrosis 1670 0.00128092426617503
primitive neuroectodermal tumor 3031 0.00202732755908726
pituitary cancer 1972 0.00311209733728553
sarcoidosis 368 0.00424729578852967
chronic lymphosyte leukemia 232 0.00598312909271136
Waldenstrons macroglobulinemia 765 0.0100030144698524
primary Sjogren syndrome 789 0.0141953058169631
aldosterone-producing adenoma 664 0.0211773908564862
invasive ductal carcinoma 2950 0.0333528136324687
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0367632927584371
active Crohn's disease 918 0.0480697039789398
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0488122166446733
Disease Target Count Z-score Confidence
Cardiac arrest 26 3.233 1.6

Expression

Synonym

Accession Q9UII5
Symbols Y8
ZFD25
ZNF588
smap-7

Gene

  Ortholog (1)

Species Source
Macaque OMA EggNOG Inparanoid

AA Sequence

MVAKPPVMSFHFAQDLWPEQNIKDSFQKVTLRRYGKCEYENLQLRKGCKHVDECTGHKGGHNTVNQCLTA      1 - 70
TPSKIFQCNKYVKVFDKFSNSNRYKRRHTGNKHFKCKECSKSFCVLSQLTQHRRIHTRVNSYKCEECGKA     71 - 140
FNWFSTLTKHKRIHTGEKPYKCEECGKAFNQSSQLTRHKIIHTEEKPNKCEECGKAFKQASHLTIHKIIH    141 - 210
TGEKPYKYEECGKVFSQSSHLTTQKILHTGENLYKCKECGKAFNLFSNLTNHKRIHAGEKPYKCKECGRA    211 - 280
FNISSNLNKQEKIHTGGKLNKCEECDKAFNRSLKLTAHKKILMEEKPYKCEECGKVFNQFSTLTRHKIIH    281 - 350
TGEKPYKCKECGKAFNQSSNLTEHKKIHTAEKSYKCEECGKAFNQHSNLINHRKIYSGEKPYKCEECGKA    351 - 420
FNRSSTLTRHKKIHTGEKPYKCEECDRAFSQSSNLTEHKKIHTGEKPYKCEECGKAFNRFSTLTKHKRIH    421 - 490
TGEKPYKCEECGKAFNQSYQLTRHKIVHTKEKLNKCEEFGKAFKQSSHRTIHKIIHTGEKPYKCEEHGKV    491 - 560
FNQSSNLTTQKIIHTGENLYKFEEHGKAFNLFSNITNHKIIYTGEKPHKCEECGKAYNRFSNLTIHKRIH    561 - 630
TGEKPYQCAECGKAFNCSSTLNRHKIIHTGEKPYKCKECGKAFNLSSTLTAHKKIHTGEKPYKCEECGKA    631 - 700
FNQSSNLTTHKKIHTSEKPYKCEECGKSFNQFSSLNIHKIIHTGEKPYKCGDYGRAFNLSSNLTTHKKIH    701 - 770
TGEKPYKCEYGKT                                                             771 - 783
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673043 1999 Cloning and characterization of a novel human gene encoding a zinc finger protein with 25 fingers.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.