Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.88
PubTator Score 6.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.011 4.8e-02
adult high grade glioma 1.400 1.5e-03
aldosterone-producing adenoma -1.219 2.1e-02
astrocytoma 1.200 1.5e-13
Astrocytoma, Pilocytic 1.300 7.1e-04
chronic lymphosyte leukemia 1.300 6.0e-03
cystic fibrosis 1.300 1.3e-03
glioblastoma 1.800 8.7e-10
group 3 medulloblastoma 1.700 3.4e-03
intraductal papillary-mucinous adenoma (... 1.200 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.7e-02
invasive ductal carcinoma 1.100 3.3e-02
lung cancer 1.100 9.3e-04
oligodendroglioma 1.300 1.1e-13
osteosarcoma -1.580 6.7e-07
pituitary cancer 1.100 3.1e-03
primary Sjogren syndrome 1.200 1.4e-02
primitive neuroectodermal tumor 1.300 2.0e-03
psoriasis -1.500 8.5e-09
sarcoidosis 1.300 4.2e-03
Waldenstrons macroglobulinemia 1.616 1.0e-02

AA Sequence

MVAKPPVMSFHFAQDLWPEQNIKDSFQKVTLRRYGKCEYENLQLRKGCKHVDECTGHKGGHNTVNQCLTA      1 - 70
TPSKIFQCNKYVKVFDKFSNSNRYKRRHTGNKHFKCKECSKSFCVLSQLTQHRRIHTRVNSYKCEECGKA     71 - 140
FNWFSTLTKHKRIHTGEKPYKCEECGKAFNQSSQLTRHKIIHTEEKPNKCEECGKAFKQASHLTIHKIIH    141 - 210
TGEKPYKYEECGKVFSQSSHLTTQKILHTGENLYKCKECGKAFNLFSNLTNHKRIHAGEKPYKCKECGRA    211 - 280
FNISSNLNKQEKIHTGGKLNKCEECDKAFNRSLKLTAHKKILMEEKPYKCEECGKVFNQFSTLTRHKIIH    281 - 350
TGEKPYKCKECGKAFNQSSNLTEHKKIHTAEKSYKCEECGKAFNQHSNLINHRKIYSGEKPYKCEECGKA    351 - 420
FNRSSTLTRHKKIHTGEKPYKCEECDRAFSQSSNLTEHKKIHTGEKPYKCEECGKAFNRFSTLTKHKRIH    421 - 490
TGEKPYKCEECGKAFNQSYQLTRHKIVHTKEKLNKCEEFGKAFKQSSHRTIHKIIHTGEKPYKCEEHGKV    491 - 560
FNQSSNLTTQKIIHTGENLYKFEEHGKAFNLFSNITNHKIIYTGEKPHKCEECGKAYNRFSNLTIHKRIH    561 - 630
TGEKPYQCAECGKAFNCSSTLNRHKIIHTGEKPYKCKECGKAFNLSSTLTAHKKIHTGEKPYKCEECGKA    631 - 700
FNQSSNLTTHKKIHTSEKPYKCEECGKSFNQFSSLNIHKIIHTGEKPYKCGDYGRAFNLSSNLTTHKKIH    701 - 770
TGEKPYKCEYGKT                                                             771 - 783
//

Text Mined References (8)

PMID Year Title