Property Summary

NCBI Gene PubMed Count 23
Grant Count 20
R01 Count 12
Funding $1,989,037.34
PubMed Score 41.34
PubTator Score 36.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
systemic lupus erythematosus 1.700 0.000
Multiple myeloma 2.057 0.001
malignant mesothelioma 4.700 0.000
cutaneous lupus erythematosus 3.100 0.000
glioblastoma 1.600 0.001
ependymoma 1.500 0.000
cystic fibrosis 2.379 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 2.926 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.009
lung cancer -3.100 0.000
diabetes mellitus 2.500 0.001
Multiple Sclerosis 2.800 0.004
pediatric high grade glioma 1.500 0.001
group 4 medulloblastoma -1.200 0.006
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 1.700 0.000
subependymal giant cell astrocytoma 2.522 0.002
lung carcinoma -1.700 0.000
ovarian cancer -2.000 0.001
pituitary cancer -2.800 0.000
dermatomyositis 1.600 0.030

Gene RIF (24)

PMID Text
26653219 HERC5 plays a crucial role in HCC immune evasion and has clinical relevance as a reproducible prognostic marker for risk of tumor recurrence and survival in patients.
26361997 The inhibitory effect of ISG15 on HCV RNA replication does not require its conjugation to substrates by HERC5.
26355087 vIRF1 association with HERC5 altered ISG15 modification of cellular proteins, and knockdown of ISG15 augmented reactivation of KSHV from latency.
26116899 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
25353388 Results show that HERC5 gene may be involved in regulating the spread of non-small cell lung cancer tumors where the methylation of its promoter is correlated with number increase of disseminated tumor cells and metastases as well as survival decreased.
25010285 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
24742225 The study reports on the NMR solution structure of a G-quadruplex formed by the CEB1 DNA G-rich fragment d(AGGGGGGAGGGAGGGTGG), harboring several G-tracts including one with six continuous guanines.
24693865 Authors identified a second distinct mechanism by which HERC5 inhibits HIV-1 replication and demonstrate that HERC5 is evolving under strong positive selection.
24693865 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
24693865 HIV-1 Vpr upregulates the gene expression of HERC5 in human monocyte-derived dendritic cells
More...

AA Sequence

MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGG      1 - 70
AGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFESILQEKKI     71 - 140
IQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSG    141 - 210
NIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNST    211 - 280
QNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEEL    281 - 350
KLESHTSEKELIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFS    351 - 420
SPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFHSPPQEALEIF    421 - 490
FLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFSKLVQMFKTAVICQLDYWDES    491 - 560
AEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHRLNFFVEVCRRYLWKMTVDASENVQCCVIFS    561 - 630
HFPFIFNNLSKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQ    631 - 700
FENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFF    701 - 770
GVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHW    771 - 840
DRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIV    841 - 910
GNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCP    911 - 980
ESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG                              981 - 1024
//

Text Mined References (28)

PMID Year Title
26653219 2015 HERC5 is a prognostic biomarker for post-liver transplant recurrent human hepatocellular carcinoma.
26361997 2015 Inhibition of hepatitis C virus RNA replication by ISG15 does not require its conjugation to protein substrates by the HERC5 E3 ligase.
26355087 2015 Kaposi's Sarcoma-Associated Herpesvirus Viral Interferon Regulatory Factor 1 Interacts with a Member of the Interferon-Stimulated Gene 15 Pathway.
25353388 2015 Identification of HERC5 and its potential role in NSCLC progression.
24742225 2014 Structure and conformational dynamics of a stacked dimeric G-quadruplex formed by the human CEB1 minisatellite.
24693865 2014 Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export.
23538710 2013 Paternal lifestyle as a potential source of germline mutations transmitted to offspring.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22093708 2011 Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
More...