Property Summary

NCBI Gene PubMed Count 25
PubMed Score 44.52
PubTator Score 36.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 4.4e-05
cutaneous lupus erythematosus 3.100 2.7e-04
cystic fibrosis 2.379 4.5e-06
dermatomyositis 1.600 3.0e-02
diabetes mellitus 2.500 1.1e-03
ependymoma 1.500 1.8e-05
glioblastoma 1.500 8.2e-05
group 4 medulloblastoma -1.200 5.7e-03
intraductal papillary-mucinous carcinoma... -1.500 8.9e-03
juvenile dermatomyositis 2.926 7.5e-17
lung cancer -1.300 7.7e-03
lung carcinoma -1.700 1.1e-15
malignant mesothelioma 4.700 1.1e-09
medulloblastoma, large-cell -1.400 5.1e-05
Multiple myeloma 2.057 1.4e-03
Multiple Sclerosis 2.800 4.0e-03
ovarian cancer -2.000 5.9e-04
pediatric high grade glioma 1.500 7.1e-04
pituitary cancer -2.800 7.2e-07
primary Sjogren syndrome 1.700 2.7e-04
subependymal giant cell astrocytoma 2.522 2.4e-03
Systemic lupus erythematosus 1.700 4.9e-04

Gene RIF (19)

AA Sequence

MERRSRRKSRRNGRSTAGKAAATQPAKSPGAQLWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGG      1 - 70
AGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFESILQEKKI     71 - 140
IQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSG    141 - 210
NIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNST    211 - 280
QNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPVKVSSSEEL    281 - 350
KLESHTSEKELIMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWQSTKREIQEIFS    351 - 420
SPACLTGSFLRKRRTTEMMPVYLDLNKARNIFKELTQKDWITNMITTCLKDNLLKRLPFHSPPQEALEIF    421 - 490
FLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVLEEYWATLQESTFSKLVQMFKTAVICQLDYWDES    491 - 560
AEENGNVQALLEMLKKLHRVNQVKCQLPESIFQVDELLHRLNFFVEVCRRYLWKMTVDASENVQCCVIFS    561 - 630
HFPFIFNNLSKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQ    631 - 700
FENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFF    701 - 770
GVLCGLSLFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHW    771 - 840
DRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIV    841 - 910
GNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCP    911 - 980
ESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG                              981 - 1024
//

Text Mined References (29)

PMID Year Title