Property Summary

NCBI Gene PubMed Count 30
Grant Count 57
R01 Count 36
Funding $6,899,527.6
PubMed Score 67.04
PubTator Score 27.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (22)

PMID Text
26523541 Case Reports: 2 girls with primary renal myoepithelial carcinomas with a novel EWSR1-KLF15 fusion.
26088140 GR and KLF15 physically interact via low affinity GR binding sites within glucocorticoid response elements (GREs) for PRODH and AASS that contribute to combinatorial regulation with KLF15.
25869021 Our results indicate that nuclear KLF15 expression suppresses breast cancer cell proliferation at least partially through p21 up-regulation and subsequent cell cycle arrest
24407292 KLF15 as a key regulator of myocardial lipid utilization and is the first to implicate the KLF transcription factor family in cardiac metabolism.
24027338 Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold.
23999430 A previously unrecognized KLF15-dependent pathway regulates vascular smooth muscle cell proinflammatory activation.
22493483 a critical role of KLF15 in mediating podocyte differentiation and in protecting podocytes against injury.
22493257 Elucidation of this heretofore unrecognized role for KLF15 now implicates this factor as a central component of the transcriptional circuitry that coordinates physiologic flux of all three basic cellular nutrients: glucose, amino acids, and lipids
22405069 Nitrogen homeostasis exhibits circadian rhythmicity, and is orchestrated by Kruppel-like factor 15.
21937448 serves as a molecular link between myogenic factors and the activity of the D4Z4 enhancer, and it thus contributes to the overexpression of the DUX4c and FRG2 genes during normal myogenic differentiation and in FSHD.
More...

AA Sequence

MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGT      1 - 70
ESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPT     71 - 140
LEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGG    141 - 210
PTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVR    211 - 280
IAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKP    281 - 350
FACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN        351 - 416
//

Publication (32)

PMID Year Title
26523541 2016 Expanding the Spectrum of Renal Tumors in Children: Primary Renal Myoepithelial Carcinomas With a Novel EWSR1-KLF15 Fusion.
26088140 2015 Response Element Composition Governs Correlations between Binding Site Affinity and Transcription in Glucocorticoid Receptor Feed-forward Loops.
25869021 2015 KLF15 in breast cancer: a novel tumor suppressor?
25416956 2014 A proteome-scale map of the human interactome network.
24407292 2014 Kruppel-like factor 15 is a critical regulator of cardiac lipid metabolism.
24027338 2013 Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter.
23999430 2013 Kruppel-like factor 15 is critical for vascular inflammation.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
22493483 2012 Kruppel-like factor 15 (KLF15) is a key regulator of podocyte differentiation.
22493257 2012 Kruppel-like factor 15 regulates skeletal muscle lipid flux and exercise adaptation.
More...