Property Summary

NCBI Gene PubMed Count 38
PubMed Score 80.50
PubTator Score 27.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.500 1.7e-02
Atopic dermatitis -1.100 2.0e-04
ductal carcinoma in situ -1.700 8.0e-05
ependymoma 1.700 3.3e-02
gastric carcinoma -1.800 2.8e-02
group 3 medulloblastoma -2.500 1.5e-05
intraductal papillary-mucinous adenoma (... -1.300 4.7e-03
intraductal papillary-mucinous carcinoma... -1.300 1.3e-02
intraductal papillary-mucinous neoplasm ... -1.700 4.9e-03
invasive ductal carcinoma -1.800 7.6e-04
lung adenocarcinoma -2.900 6.0e-16
non primary Sjogren syndrome sicca 1.500 3.1e-02
non-small cell lung cancer -1.209 3.8e-15
oligodendroglioma 1.500 1.6e-02
osteosarcoma 1.048 1.3e-04
ovarian cancer 1.200 8.3e-14
pancreatic cancer -1.400 1.0e-05
pituitary cancer -2.000 1.5e-05
psoriasis 2.100 1.6e-04

Protein-protein Interaction (3)

Gene RIF (30)

AA Sequence

MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGT      1 - 70
ESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPT     71 - 140
LEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGG    141 - 210
PTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVR    211 - 280
IAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKP    281 - 350
FACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN        351 - 416
//

Text Mined References (40)

PMID Year Title