Property Summary

NCBI Gene PubMed Count 23
PubMed Score 24.09
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.400 4.8e-03
Breast cancer -1.100 4.4e-04
cystic fibrosis 1.733 2.4e-05
glioblastoma -1.200 2.5e-02
group 3 medulloblastoma -1.600 2.4e-04
intraductal papillary-mucinous adenoma (... -1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.7e-02
lung cancer 2.300 1.0e-05
malignant mesothelioma -2.300 2.6e-05
medulloblastoma, large-cell -1.100 7.0e-05
nephrosclerosis 1.268 1.3e-04
osteosarcoma -1.712 1.0e-03
ovarian cancer -2.000 1.2e-06
Pick disease 1.100 1.8e-04
pituitary cancer -1.100 9.1e-04
psoriasis -1.500 2.2e-08

Gene RIF (10)

AA Sequence

MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERR      1 - 70
FNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEI     71 - 140
RWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKD    141 - 210
SSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSL    211 - 280
LMFGFPQSLPPHSEPAMESEQAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPV    281 - 350
FTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA    351 - 420
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADG    421 - 490
ITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFLCVMCICSLIGAMAQTPSVII    491 - 560
LIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIA    561 - 630
IALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDH    631 - 700
EWCENMESVL                                                                701 - 710
//

Text Mined References (26)

PMID Year Title