Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.97
PubTator Score 17.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.268 0.000
malignant mesothelioma -5.200 0.000
psoriasis -1.500 0.000
osteosarcoma -1.712 0.001
group 4 medulloblastoma -2.100 0.000
cystic fibrosis 1.733 0.000
glioblastoma -1.200 0.025
medulloblastoma, large-cell -2.200 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.001
intraductal papillary-mucinous neoplasm ... 1.500 0.037
lung cancer 2.300 0.000
adult high grade glioma -1.400 0.005
Pick disease 1.100 0.000
Breast cancer -1.100 0.000
ovarian cancer -2.100 0.000
pituitary cancer -1.100 0.001

Synonym

Accession Q9UIG8 A8K4A7 B3KPY5 B3KUR7 C6G486 Q9BW73 Q9GZV2 OATP3A1
Symbols OATPD
OATP-D
OATP3A1
OATPRP3
OATP-RP3
SLC21A11

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
26349991 our results revealed altered OATP3A1 and OATP4A1 mRNA levels and novel mechanisms that might be involved in their regulation in colorectal cancer
24945726 SLCO3A1, a novel Crohn's disease-associated gene, mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation.
22377092 Single nucleotide polymorhpisms of SLCO3A1 were associated with nicotine dependence.
21486766 Compared with the adult cerebral cortex, mRNAs encoding OATP1A2, OATP1C1, OATP3A1 variant 2, OATP4A1, LAT2 and CD98 were reduced in fetal cortex at different gestational ages, whilst mRNAs encoding MCT8, MCT10, OATP3A1 variant 1 and LAT1 were similar.
21278488 tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19330903 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18521091 Genome-wide association study of gene-disease association. (HuGE Navigator)
16971491 Further evidence is provided for the involvement of OATPs in oligopeptide transport. OATP3A1 variants might be involved in the regulation of extracellular vasopressin concentration in human brain.
14631946 OATP-D plays an important role in translocating prostaglandins in specialized tissues and cells.

AA Sequence

MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERR      1 - 70
FNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEI     71 - 140
RWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKD    141 - 210
SSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSL    211 - 280
LMFGFPQSLPPHSEPAMESEQAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPV    281 - 350
FTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA    351 - 420
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADG    421 - 490
ITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFLCVMCICSLIGAMAQTPSVII    491 - 560
LIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIA    561 - 630
IALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDH    631 - 700
EWCENMESVL                                                                701 - 710
//

Text Mined References (25)

PMID Year Title
26349991 2015 Effect of DNA methylation profile on OATP3A1 and OATP4A1 transcript levels in colorectal cancer.
24945726 2014 SLCO3A1, A novel crohn's disease-associated gene, regulates nf-?B activity and associates with intestinal perforation.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22377092 2012 ANAPC1 and SLCO3A1 are associated with nicotine dependence: meta-analysis of genome-wide association studies.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
21486766 2011 The expression of thyroid hormone transporters in the human fetal cerebral cortex during early development and in N-Tera-2 neurodifferentiation.
More...