Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
R01 Count 5
Funding $354,865.83
PubMed Score 10.16
PubTator Score 23.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
Atopic dermatitis -2.700 0.000
ovarian cancer 1.100 0.000

Gene RIF (5)

PMID Text
22821332 In Czech population, association between HLA-Cw*06 and psoriatic arthritis was low and restricted to psoriatic arthritis patients with early psoriasis onset
19851445 Observational study of gene-disease association. (HuGE Navigator)
15523160 HLA-Cw*06 allele frequency is associated with psoriasis
12930300 In a case-control study, five of the nine single nucleotide polymorphisms (SNPs) found in SEEK1 were associated with psoriasis, while one of the four SNPs found in SPR1 showed association.
12823445 HLA-Cw6 remains the major risk allele in Chinese psoriatics, and that the SPR1 gene might not play an important role in the causation of PV.

AA Sequence

MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPLFEDPPPTRPS      1 - 70
RPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDNRPQEEPDLDPPREEYR         71 - 136
//

Text Mined References (14)

PMID Year Title
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22821332 2013 The HLA-Cw*06 allele and -1149 G/T polymorphism of extrapituitary promoter of PRL gene as a possible common genetic predisposing factors to psoriasis vulgaris and psoriatic arthritis in Czech population.
21750679 2011 Genome-wide scan identifies TNIP1, PSORS1C1, and RHOB as novel risk loci for systemic sclerosis.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
15523160 2004 Correlation of HLA-Cw*06 allele frequency with some clinical features of psoriasis vulgaris in the population of northern Poland.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...