Property Summary

NCBI Gene PubMed Count 19
PubMed Score 110.95
PubTator Score 26.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -2.400 0.000
osteosarcoma -2.021 0.000
lung cancer -2.200 0.000
acute myeloid leukemia 1.600 0.018

Synonym

Accession Q9UIF9 B3KN66 O00536 O15030 Q68DI8 Q96H26
Symbols TIP5
WALp3

Gene

PDB

4LZ2   4Q6F   4QBM   4QF2   5AGQ  

Gene RIF (9)

PMID Text
26100909 Data show that SUMOylated BANP, E5R, and Nac1 (BEN) domain 3 (BEND3) stabilizes NoRC component TTF-1-interacting protein 5 (Tip5)via association with ubiquitin specific protease 21 (USP21) debiquitinase
25916849 The study showed that the NMR structure of the TAM domain of TIP5 resembles the fold of the MBD domain, found in methyl-CpG binding proteins.
25533489 Crystal structures of PHD zinc finger and bromodomains from human TIP5 and BAZ2B in free form and bound to H3 and/or H4 histones.
25485837 BAZ2A is overexpressed in prostate cancer, maintains its cell growth, regulates protein-coding genes, and interacts with EZH2 to silence genes repressed in metastasis. Its overexpression is associated with a CpG island methylator phenotype.
25479748 association with ribosomal DNA is impaired in embryonic stem cells and occurs upon cell differentiation
25216700 High BAZ2A expression is associated with pancreatic cancer.
23333304 HIV-1 Vif downregulates the expression of bromodomain adjacent to zinc finger domain protein 2A (BAZ2A) in Vif-expression T cells
19578370 Data show that MOF acetylates TIP5, the largest subunit of NoRC, at a single lysine residue, K633, adjacent to the TIP5 RNA-binding domain, and that SIRT1 (removes the acetyl group from K633.
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 1 is discussed

AA Sequence

MEMEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLSTVSHTTTSGIL      1 - 70
NSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNT     71 - 140
NLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVG    141 - 210
SGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDD    211 - 280
PSHLPDQLEDTPILSEDSLEPFNSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATA    281 - 350
FSLLADDSQTSTSIFASPTSPPVLGESVLQDNSFDLNNGSDAEQEEMETQSSDFPPSLTQPAPDQSSTIQ    351 - 420
LHPATSPAVSPTTSPAVSLVVSPAASPEISPEVCPAASTVVSPAVFSVVSPASSAVLPAVSLEVPLTASV    421 - 490
TSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGDVMRRRIATPEEVRLPLQHGW    491 - 560
RREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRNVVHSVRREHFSFSPRMPVGDFFEERDTPEG    561 - 630
LQWVQLSAEEIPSRIQAITGKRGRPRNTEKAKTKEVPKVKRGRGRPPKVKITELLNKTDNRPLKKLEAQE    631 - 700
TLNEEDKAKIAKSKKKMRQKVQRGECQTTIQGQARNKRKQETKSLKQKEAKKKSKAEKEKGKTKQEKLKE    701 - 770
KVKREKKEKVKMKEKEEVTKAKPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSR    771 - 840
VPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLLVRLLKAALHD    841 - 910
PGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGVEPALCDRLRTQPFQAQPPQQKAAVLAFLVH    911 - 980
ELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAKRTGRSEVEMEGPEECLGRRRSSRIMEET    981 - 1050
SGMEEEEEEESIAAVPGRRGRRDGEVDATASSIPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDR   1051 - 1120
YRRRYWVLPYLAGIFVEGTEGNLVPEEVIKKETDSLKVAAHASLNPALFSMKMELAGSNTTASSPARARG   1121 - 1190
RPRKTKPGSMQPRHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQLQSHKGFLEQEGSPLSLGQS   1191 - 1260
QHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPAPSQPPEEPEPDEAESSPDPQALWFNISAQM   1261 - 1330
PCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPSAANPCSPVQFSSTPLAGLAPKRRAGDPGEMPQSPTG   1331 - 1400
LGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCSGWWWIRDPEMLDAMLKALHPRGIREKALHKHLN   1401 - 1470
KHRDFLQEVCLRPSADPIFEPRQLPAFQEGIMSWSPKEKTYETDLAVLQWVEELEQRVIMSDLQIRGWTC   1471 - 1540
PSPDSTREDLAYCEHLSDSQEDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERRYLREPLWPTH   1541 - 1610
EVVLEKALLSTPNGAPEGTTTEISYEITPRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCL   1611 - 1680
VCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYS   1681 - 1750
LNFSEGDGRRRRVLLRGRESPAAGPRYSEEGLSPSKRRRLSMRNHHSDLTFCEIILMEMESHDAAWPFLE   1751 - 1820
PVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFF   1821 - 1890
ESRWEEFYQGKQANL                                                          1891 - 1905
//

Text Mined References (30)

PMID Year Title
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25916849 2015 A novel RNA binding surface of the TAM domain of TIP5/BAZ2A mediates epigenetic regulation of rRNA genes.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25533489 2015 Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
25485837 2015 BAZ2A (TIP5) is involved in epigenetic alterations in prostate cancer and its overexpression predicts disease recurrence.
25479748 2014 lncRNA maturation to initiate heterochromatin formation in the nucleolus is required for exit from pluripotency in ESCs.
25216700 2015 Protein deep sequencing applied to biobank samples from patients with pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
More...