Property Summary

Ligand Count 13
NCBI Gene PubMed Count 16
PubMed Score 151.08
PubTator Score 5.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 2.000 3.0e-03
ependymoma 1.500 2.3e-02
group 3 medulloblastoma 1.300 2.6e-02
malignant mesothelioma -2.400 2.8e-08
ovarian cancer -1.600 3.3e-06
Pick disease -1.500 2.0e-04
primitive neuroectodermal tumor 1.300 1.7e-02
progressive supranuclear palsy -2.100 7.4e-03

Synonym

Accession Q9UIF8 D3DPA8 Q96EA1 Q96SQ8 Q9P252 Q9Y4N8
Symbols WALp4

Gene

PDB

2E7O   3G0L   3Q2F   4CUP   4CUQ   4CUR   4CUS   4CUT   4CUU   4IR3   4IR4   4IR5   4IR6   4NR9   4NRA   4NRB   4NRC   4QC1   4QC3   4QF3   4RVR   4XUA   4XUB   5CQ3   5CQ4   5CQ5   5CQ6   5CQ7   5CQ8   5CQA   5CU8   5CUA   5CUB   5CUC   5CUD   5CUE   5CUG   5DYU   5DYX   5E73   5E74   5E9I   5E9K   5E9L   5E9M   5E9Y   5L8T   5L8U   5L96   5L97   5L98   5L99   5MGE   5MGF   5MGG   5OR9   5ORB   5PB7   5PB8   5PB9   5PBA   5PBB   5PBC   5PBD   5PBE   5PBF   5PBG   5PBH   5PBI   5PBJ   5PBK   5PBL   5PBM   5PBN   5PBO   5PBP   5PBQ   5PBR   5PBS   5PBT   5PBU   5PBV   5PBW   5PBX   5PBY   5PBZ   5PC0   5PC1   5PC2   5PC3   5PC4   5PC5   5PC6   5PC7   5PC8   5PC9   5PCA   5PCB   5PCC   5PCD   5PCE   5PCF   5PCG   5PCH   5PCI   5PCJ   5PCK   5PCL   5PCM   5PCN   5PCO   5PCP   5PCQ   5PCR   5PCS   5PCT   5PCU   5PCV   5PCW   5PCX   5PCZ   5PD0   5PD1   5PD2   5PD3   5PD4   5PD5   5PD6   5PD7   5PD8   5PD9   5PDA   5PDB   5PDC   5PDD   5PDE   5PDF   5PDG   5PDH   5PDI   5PDJ   5PDK   5PDL   5PDM   5PDN   5PDO   5PDP   5PDQ   5PDR   5PDS   5PDT   5PDU   5PDV   5PDW   5PDX   5PDY   5PDZ   5PE0   5PE1   5PE2   5PE3   5PE4   5PE5   5PE6   5PE7   5PE8   5PE9   5PEA   5PEB   5PEC   5PED   5PEE   5PEF   5PEG   5PEH   5PEI   5PEJ   5PEK   5PEL   5PEM   5PEN   5PEO   5PEQ   5PER   5PES   5PET   5PEU   5PEV   5PEW   5PEX   5PEY   5PEZ   5PF0   5PF1   5PF2   5PF3   5PF4   5PF5   5PF6   5PF7   5PF8   5PF9   5PFA   5PFB   5PFC   5PFD   5PFE   5PFF   5PFG   5PFH   5PFI   5PFJ   5PFL   5PFM   5PFN   5PFO   5PFP   5PFQ   5PFR   5PFS   5PFT   5PFU   5PFV   5PFW   5PFX   5PFY   5PFZ   5PG0   5PG1   5PG2   5PG3   5PG4   5PG5   5PG6   5PG7   5PG8   5PG9   5PGA   5PGB   5PGC   5PGD   5PGE   5PGF   5PGG   5PGH   5PGI   5PGJ   5PGK   5PGL   5PGN   5PGO   5PGP   5PGQ   5PGR   5PGS   5PGT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSSTINPCGHLFRTAGDQPFNLSTVSSAFP      1 - 70
MVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWRTTDAHTRTGATFFPPLLGIPPLF     71 - 140
APPAQNHDSSSFHSRTSGKSNRNGPEKGVNGSINGSNTSSVIGINTSVLSTTASSSMGQTKSTSSGGGNR    141 - 210
KCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIE    211 - 280
ESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVL    281 - 350
SQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEES    351 - 420
SLLTSELRSKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHPNPFLTNALLG    421 - 490
NHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSASPILH    491 - 560
SQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPSSKDSEDSNEDEEEDDEEEDEEDDEDDESDD    561 - 630
SQSESDSNSESDTEGSEEEDDDDKDQDESDSDTEGEKTSMKLNKTTSSVKSPSMSLTGHSTPRNLHIAKA    631 - 700
PGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSKRRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEV    701 - 770
AYYAPCGKKLRQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRA    771 - 840
MEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQIKLLRKLQKQ    841 - 910
EQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAANAKL    911 - 980
LEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEARKKAEEKERLKQEKRDEKRLNKERKLEQRR    981 - 1050
LELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSV   1051 - 1120
LQEGLLNIGDSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQ   1121 - 1190
TELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHA   1191 - 1260
KKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEEDKEDKKGKKTD   1261 - 1330
ICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVEGM   1331 - 1400
ESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSNTDHCEQKEDLKEKDNTNLFLQKPGSFSKLS   1401 - 1470
KLLEVAKMPPESEVMTPKPNAGANGCTLSYQNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFY   1471 - 1540
SPLPNDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKSPSPTPAPLGSSAQNPV   1541 - 1610
GLNPFALSPLQVKGGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSKSES   1611 - 1680
PVPQNEKATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIREKALQKQIQK   1681 - 1750
HLDYITQACLKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQVKGW   1751 - 1820
MCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAHALERKSDNPLDIAVTRLADLERNIERRIEE   1821 - 1890
DIAPGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYC   1891 - 1960
HRPKITTIPDGDWFCPACIAKASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGN   1961 - 2030
KDLKKRKMEENTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKV   2031 - 2100
IKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS     2101 - 2168
//

Text Mined References (22)

PMID Year Title