Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 4
Funding $855,868.75
PubMed Score 130.09
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
astrocytic glioma 2.000 0.003
ependymoma 1.500 0.023
medulloblastoma 1.500 0.000
primitive neuroectodermal tumor 1.300 0.017
Pick disease -1.500 0.000
progressive supranuclear palsy -2.100 0.007
ovarian cancer -1.600 0.000

Synonym

Accession Q9UIF8 D3DPA8 Q96EA1 Q96SQ8 Q9P252 Q9Y4N8
Symbols WALp4

Gene

PDB

2E7O   3G0L   3Q2F   4CUP   4CUQ   4CUR   4CUS   4CUT   4CUU   4IR3   4IR4   4IR5   4IR6   4NR9   4NRA   4NRB   4NRC   4QC1   4QC3   4QF3   4RVR   4XUA   4XUB   5CQ3   5CQ4   5CQ5   5CQ6   5CQ7   5CQ8   5CQA   5CU8   5CUA   5CUB   5CUC   5CUD   5CUE   5CUG   5DYU   5DYX   5E73   5E74   5E9I   5E9K   5E9L   5E9M   5E9Y  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
504333 confirmatory 15779 / 31301 / 312744 qHTS Assay for Inhibitors of BAZ2B
504391 summary 0 / 0 / 0 qHTS Assay for Inhibitors of BAZ2B: Summary
588809 confirmatory 23 / 2 / 0 qHTS Assay for Inhibitors of BAZ2B: Hit Validation

Gene RIF (2)

PMID Text
20802025 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of bromodomain adjacent to zinc finger domain, 2B (BAZ2B) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSSTINPCGHLFRTAGDQPFNLSTVSSAFP      1 - 70
MVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWRTTDAHTRTGATFFPPLLGIPPLF     71 - 140
APPAQNHDSSSFHSRTSGKSNRNGPEKGVNGSINGSNTSSVIGINTSVLSTTASSSMGQTKSTSSGGGNR    141 - 210
KCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIE    211 - 280
ESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVL    281 - 350
SQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEES    351 - 420
SLLTSELRSKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHPNPFLTNALLG    421 - 490
NHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTSGRRTPGNQTPVMPSASPILH    491 - 560
SQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPSSKDSEDSNEDEEEDDEEEDEEDDEDDESDD    561 - 630
SQSESDSNSESDTEGSEEEDDDDKDQDESDSDTEGEKTSMKLNKTTSSVKSPSMSLTGHSTPRNLHIAKA    631 - 700
PGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSKRRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEV    701 - 770
AYYAPCGKKLRQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRA    771 - 840
MEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQIKLLRKLQKQ    841 - 910
EQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAANAKL    911 - 980
LEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEARKKAEEKERLKQEKRDEKRLNKERKLEQRR    981 - 1050
LELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSV   1051 - 1120
LQEGLLNIGDSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQ   1121 - 1190
TELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHA   1191 - 1260
KKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEEDKEDKKGKKTD   1261 - 1330
ICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVEGM   1331 - 1400
ESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSNTDHCEQKEDLKEKDNTNLFLQKPGSFSKLS   1401 - 1470
KLLEVAKMPPESEVMTPKPNAGANGCTLSYQNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFY   1471 - 1540
SPLPNDQLLKTLTEKNRQWFSLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKSPSPTPAPLGSSAQNPV   1541 - 1610
GLNPFALSPLQVKGGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSKSES   1611 - 1680
PVPQNEKATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIREKALQKQIQK   1681 - 1750
HLDYITQACLKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQVKGW   1751 - 1820
MCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAHALERKSDNPLDIAVTRLADLERNIERRIEE   1821 - 1890
DIAPGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYC   1891 - 1960
HRPKITTIPDGDWFCPACIAKASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGN   1961 - 2030
KDLKKRKMEENTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKV   2031 - 2100
IKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS     2101 - 2168
//

Text Mined References (19)

PMID Year Title
26942307 2016 High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography.
25719566 2015 Structure enabled design of BAZ2-ICR, a chemical probe targeting the bromodomains of BAZ2A and BAZ2B.
25416956 2014 A proteome-scale map of the human interactome network.
25266743 2014 Binding hotspots of BAZ2B bromodomain: Histone interaction revealed by solution NMR driven docking.
24304323 2013 Targeting low-druggability bromodomains: fragment based screening and inhibitor design against the BAZ2B bromodomain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
21738491 2011 Identification of a sudden cardiac death susceptibility locus at 2q24.2 through genome-wide association in European ancestry individuals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20802025 2010 Genome-wide association study identifies novel loci for plasma levels of protein C: the ARIC study.
More...