Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.72
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q9UIF3 A6NIS6 O60638
Symbols TEKTB1
TEKTIN-T
h-tektin-t

Gene

Gene RIF (3)

PMID Text
26584823 These results suggested that tektin-t variants (Arg/Cys + Cys/Cys) were probably one of the high risk genetic factors for idiopathic asthenozoospermia among males in Sichuan, China, while the R207H polymorphism may be associated with idiopathic asthenozoospermia risk.
23519396 Levels of Tektin 2 and CatSper 2 proteins are positively associated with sperm motility parameters. Measurements of Tektin 2 levels can be correlated with the clinical outcome of ICSI.
18227105 This is the first description of human pathology linked to a tektin-family gene, since only murine models are available for these genes.

AA Sequence

MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDT      1 - 70
VNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKE     71 - 140
VEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPD    141 - 210
GSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELK    211 - 280
WQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIA    281 - 350
ALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLS    351 - 420
PLKSCQLELA                                                                421 - 430
//

Text Mined References (11)

PMID Year Title
26584823 2016 Association of polymorphisms in tektin-t gene with idiopathic asthenozoospermia in Sichuan, China.
23519396 2013 Levels of Tektin 2 and CatSper 2 in normozoospermic and oligoasthenozoospermic men and its association with motility, fertilization rate, embryo quality and pregnancy rate.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18227105 2008 A possible association of a human tektin-t gene mutation (A229V) with isolated non-syndromic asthenozoospermia: case report.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340058 2004 Mice deficient in the axonemal protein Tektin-t exhibit male infertility and immotile-cilium syndrome due to impaired inner arm dynein function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12029069 2002 Cloning and characterization of the human tektin-t gene.
More...