Property Summary

NCBI Gene PubMed Count 7
Grant Count 309
R01 Count 188
Funding $23,551,180.02
PubMed Score 363.76
PubTator Score 42.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UID3 Q6PJV5 Q7L8A6 Q8WZ35 Q96DF4 Q96GR3
Symbols FFR
ANG2
ANG3
C11orf2
C11orf3

Gene

PDB

4J2C  

Gene RIF (2)

PMID Text
23932592 A dityrosine motif of Ang2 interacts with a highly conserved groove in Syntaxin 6.
20685960 Ang2 is the missing component of the Golgi-associated retrograde protein complex in most eukaryotes.

AA Sequence

MAAAAAAGPSPGSGPGDSPEGPEGEAPERRRKAHGMLKLYYGLSEGEAAGRPAGPDPLDPTDLNGAHFDP      1 - 70
EVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLA     71 - 140
TNMAVITDFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLTKCVELGAYGQAVRYQGRAQAVL    141 - 210
QQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGGSGAPEQAECVELLLALGEPAEELCEEFLAHARGRL    211 - 280
EKELRNLEAELGPSPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFA    281 - 350
LVERRLAQEQGGGDNSLLVRALDRFHRRLRAPGALLAAAGLADAATEIVERVARERLGHHLQGLRAAFLG    351 - 420
CLTDVRQALAAPRVAGKEGPGLAELLANVASSILSHIKASLAAVHLFTAKEVSFSNKPYFRGEFCSQGVR    421 - 490
EGLIVGFVHSMCQTAQSFCDSPGEKGGATPPALLLLLSRLCLDYETATISYILTLTDEQFLVQDQFPVTP    491 - 560
VSTLCAEARETARRLLTHYVKVQGLVISQMLRKSVETRDWLSTLEPRNVRAVMKRVVEDTTAIDVQVGLL    561 - 630
YEEGVRKAQSSDSSKRTFSVYSSSRQQGRYAPSYTPSAPMDTNLLSNIQKLFSERIDVFSPVEFNKVSVL    631 - 700
TGIIKISLKTLLECVRLRTFGRFGLQQVQVDCHFLQLYLWRFVADEELVHLLLDEVVASAALRCPDPVPM    701 - 770
EPSVVEVICERG                                                              771 - 782
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
23932592 2013 Structural basis for the interaction of the Golgi-Associated Retrograde Protein Complex with the t-SNARE Syntaxin 6.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20685960 2010 Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...