Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.19
PubTator Score 6.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 1.0e-02
Breast cancer -1.200 8.2e-08
ependymoma 1.300 5.3e-03
Gaucher disease type 1 -1.500 3.2e-02
group 3 medulloblastoma 1.200 4.6e-03
interstitial lung disease 1.200 8.6e-03
intraductal papillary-mucinous adenoma (... 2.300 3.3e-04
intraductal papillary-mucinous carcinoma... 1.900 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-02
medulloblastoma, large-cell 1.400 4.5e-04
oligodendroglioma 1.500 1.0e-03
osteosarcoma -1.859 5.4e-06
ovarian cancer -1.500 2.7e-12
Pick disease 1.500 1.3e-05
subependymal giant cell astrocytoma -1.639 4.8e-02

Gene RIF (7)

AA Sequence

MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKL      1 - 70
VSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDDYVFRNAITDVTRF     71 - 140
LQDSVEYCIIGVTILSQLTNEINQADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASGKNLNLNDE    141 - 210
SQHGLLMQLLKLTHNCLNFDFIGTSTDESSDDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLV    211 - 280
LSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRILENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVE    281 - 350
NYPEVIRLIANFTVTSLQHWEFAPNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLES    351 - 420
VHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQE    421 - 490
GRLTWLVYIIGAVIGGRVSFASTDEQDAMDGELVCRVLQLMNLTDSRLAQAGNEKLELAMLSFFEQFRKI    491 - 560
YIGDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYWGRCEPITSKTLQLLNDLSIGYSSVRKL    561 - 630
VKLSAVQFMLNNHTSEHFSFLGINNQSNLTDMRCRTTFYTALGRLLMVDLGEDEDQYEQFMLPLTAAFEA    631 - 700
VAQMFSTNSFNEQEAKRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPACTTP    701 - 770
VLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRILTLGEVPKDQVYALKLKGISICFSMLK    771 - 840
AALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEP    841 - 910
HVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSTKKRTTPLNQESDRFLHIMQQHPEMIQ    911 - 980
QMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNL    981 - 1050
LTKNRDRFTQNLSAFRREVNDSMKNSTYGVNSNDMMS                                    1051 - 1087
//

Text Mined References (20)

PMID Year Title