Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.11
PubTator Score 6.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.65704672908291E-12
Breast cancer 3099 8.20891471375627E-8
Pick disease 1893 1.34260033913346E-5
osteosarcoma 7933 3.57659391244069E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.33304593344652E-4
medulloblastoma, large-cell 6234 4.54738485941082E-4
oligodendroglioma 2849 0.0010347746490385
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00131318042875766
astrocytic glioma 2241 0.0022969524875617
group 3 medulloblastoma 2254 0.00456129753705165
ependymoma 2514 0.00709381680993117
interstitial lung disease 292 0.00858146940062052
Gaucher disease type 1 171 0.0315494590730478
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0326642575487456
subependymal giant cell astrocytoma 2287 0.0479224037370421

Expression

Synonym

Accession Q9UIA9 O94846 Q6PJK9 Q8NEK7 Exp7
Symbols EXP7
RANBP16

Gene

PANTHER Protein Class (1)

  Ortholog (11)

 GWAS Trait (1)

Pathway (1)

Gene RIF (7)

PMID Text
25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
25694352 Human oligodendrogliomas cells stably expressing mutant XPO7 showed altered cell proliferation.
24625450 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 have roles in serous epithelial ovarian cancer
23906023 Knockdown of XPO7 reduced the amount of nuclear p65 following TNF stimulation. XPO7 binding to p65 is NLS independent
20503194 These biochemical and functional data reveal RANBP16 and RANBP17 as novel regulators of E2A protein action, and demonstrate specific interaction of E12 with RANBP17.
18256292 STRADalpha facilitates nuclear export of LKB1 by serving as an adaptor between LKB1 and exportins CRM1 and exportin7.
15282546 Exportin 7-dependent nuclear export signals differ fundamentally from the leucine-rich, CRM1-dependent ones

AA Sequence

MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKL      1 - 70
VSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDDYVFRNAITDVTRF     71 - 140
LQDSVEYCIIGVTILSQLTNEINQADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASGKNLNLNDE    141 - 210
SQHGLLMQLLKLTHNCLNFDFIGTSTDESSDDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLV    211 - 280
LSCLVQIASVRRSLFNNAERAKFLSHLVDGVKRILENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVE    281 - 350
NYPEVIRLIANFTVTSLQHWEFAPNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLES    351 - 420
VHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQE    421 - 490
GRLTWLVYIIGAVIGGRVSFASTDEQDAMDGELVCRVLQLMNLTDSRLAQAGNEKLELAMLSFFEQFRKI    491 - 560
YIGDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNLKYWGRCEPITSKTLQLLNDLSIGYSSVRKL    561 - 630
VKLSAVQFMLNNHTSEHFSFLGINNQSNLTDMRCRTTFYTALGRLLMVDLGEDEDQYEQFMLPLTAAFEA    631 - 700
VAQMFSTNSFNEQEAKRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPACTTP    701 - 770
VLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRILTLGEVPKDQVYALKLKGISICFSMLK    771 - 840
AALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQDHMNFIASLEP    841 - 910
HVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSTKKRTTPLNQESDRFLHIMQQHPEMIQ    911 - 980
QMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNL    981 - 1050
LTKNRDRFTQNLSAFRREVNDSMKNSTYGVNSNDMMS                                    1051 - 1087
//

Text Mined References (20)

PMID Year Title
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
25694352 2015 Tumor-specific mutations in low-frequency genes affect their functional properties.
25416956 2014 A proteome-scale map of the human interactome network.
24625450 2014 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 are new prognostic biomarkers in serous epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23906023 2013 KPNB1, XPO7 and IPO8 mediate the translocation ofNF-?B/p65 into the nucleus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22509282 2012 Assessment of the red cell proteome of young patients with unexplained hemolytic anemia by two-dimensional differential in-gel electrophoresis (DIGE).
21269460 2011 Initial characterization of the human central proteome.
20503194 2010 Identification of RANBP16 and RANBP17 as novel interaction partners for the bHLH transcription factor E12.
More...