Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.35
PubTator Score 7.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 2.1e-03
interstitial cystitis 1.300 8.0e-03
lung carcinoma -1.700 3.4e-25
osteosarcoma -1.268 1.0e-02
subependymal giant cell astrocytoma 1.759 8.1e-03

Synonym

Accession Q9UIA0 Q5R3F9 Q9UGT6
Symbols CYT4
PSCD4
DJ63G5.1
cytohesin-4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK      1 - 70
KFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNL     71 - 140
VQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPF    141 - 210
ERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRW    211 - 280
FILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKH    281 - 350
ESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ                              351 - 394
//

Text Mined References (15)

PMID Year Title