Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $383,453.33
PubMed Score 9.29
PubTator Score 7.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 0.002
osteosarcoma -1.268 0.010
interstitial cystitis 1.500 0.001
subependymal giant cell astrocytoma 1.759 0.008
lung carcinoma -1.700 0.000

Synonym

Accession Q9UIA0 Q5R3F9 Q9UGT6
Symbols CYT4
PSCD4
DJ63G5.1
cytohesin-4

Gene

Gene RIF (2)

PMID Text
25240857 This is the first evidence of a link between a primate-specific short tandem repeat of promoter of CYTH4 and a major psychiatric disorder in human
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK      1 - 70
KFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNL     71 - 140
VQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPF    141 - 210
ERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRW    211 - 280
FILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKH    281 - 350
ESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ                              351 - 394
//

Text Mined References (14)

PMID Year Title
25240857 2015 A primate-specific functional GTTT-repeat in the core promoter of CYTH4 is linked to bipolar disorder in human.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18084281 2008 GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...