Property Summary

NCBI Gene PubMed Count 49
Grant Count 65
R01 Count 56
Funding $3,792,759.54
PubMed Score 49.75
PubTator Score 44.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UI95 B3KNE3 Q5TGW7 Q9UNA7 Q9Y6I6
Symbols REV7
MAD2B
POLZ2

Gene

PDB

3ABD   3ABE   3VU7   4EXT   4GK0   4GK5  

Gene RIF (25)

PMID Text
25799992 results reveal an unexpected crucial function of REV7 downstream of 53BP1 in coordinating pathological DSB repair pathway choices in BRCA1-deficient cells
25799990 data establish MAD2L2 as a crucial contributor to the control of DNA repair activity by 53BP1 that promotes NHEJ by inhibiting 5' end resection downstream of RIF1
25651564 that MAD2B may play an important role in high glucose-mediated podocyte injury of diabetic nephropathy via modulation of Cdh1, cyclin B1, and Skp2 expression
24597627 These findings indicate that depletion of REV7 enhances sensitivity to cisplatin treatment in ovarian clear cell carcinoma (CCC), suggesting that REV7 is a candidate molecular target in CCC management.
24100295 MAD2L2 helps to ensure a robustly bistable switch between APC/C(CDC20) and APC/C(CDH1) during the metaphase-to-anaphase transition, thereby contributing to mitotic fidelity.
23287467 REV7 is required for anaphase-promoting complex-dependent ubiquitination and degradation of translesion DNA polymerase REV1.
22869133 ternary complex of the C-terminal domain of human REV1 in complex with REV7 bound to a REV3 fragment has been crystallized. The crystals belonged to space group P3(1)21, with unit-cell parameters a = b = 74.7, c = 124.5 A
22859296 analysis of the crystal structure of the ternary complex composed of the C-terminal domain of human REV1, REV7, and a REV3 fragment
22828282 the Rev1 C-terminal domain utilizes independent interaction interfaces to simultaneously bind a fragment of the 'inserter' poleta and Rev7 subunit of the 'extender' polvarsigma, thereby serving as a cassette that may accommodate several polymerases
22660985 MAD2B may mediate Sim2 function during development in CNS and thereby play a critical role in pathophysiological mechanisms in Down syndrome
More...

AA Sequence

MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC      1 - 70
VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN     71 - 140
PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG    141 - 210
S//

Text Mined References (49)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25799992 2015 REV7 counteracts DNA double-strand break resection and affects PARP inhibition.
25799990 2015 MAD2L2 controls DNA repair at telomeres and DNA breaks by inhibiting 5' end resection.
25651564 2015 MAD2B contributes to podocyte injury of diabetic nephropathy via inducing cyclin B1 and Skp2 accumulation.
25416956 2014 A proteome-scale map of the human interactome network.
24597627 2014 Suppression of REV7 enhances cisplatin sensitivity in ovarian clear cell carcinoma cells.
24100295 2013 Sequestration of CDH1 by MAD2L2 prevents premature APC/C activation prior to anaphase onset.
23287467 2013 REV7 is required for anaphase-promoting complex-dependent ubiquitination and degradation of translesion DNA polymerase REV1.
22869133 2012 Crystallization and X-ray diffraction analysis of the ternary complex of the C-terminal domain of human REV1 in complex with REV7 bound to a REV3 fragment involved in translesion DNA synthesis.
22859296 2012 Structural basis of recruitment of DNA polymerase ? by interaction between REV1 and REV7 proteins.
More...