Property Summary

NCBI Gene PubMed Count 54
PubMed Score 56.46
PubTator Score 44.73

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC      1 - 70
VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN     71 - 140
PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG    141 - 210
S//

Text Mined References (54)

PMID Year Title