Knowledge Summary

Patent

No data available

Synonym

Accession Q9UI72
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGMALELYWLCGFRSYWPLGTNAENEGNRKENRRQMQSRNERGCNVRQTKTYRDREADRHIHGIACLLF       1 - 69
//