Property Summary

NCBI Gene PubMed Count 69
PubMed Score 0.00
PubTator Score 19.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.11255080047519E-45
astrocytoma 1493 9.84602561417553E-24
oligodendroglioma 2849 5.09900576468267E-15
posterior fossa group B ependymoma 1530 2.9018431183863E-14
ovarian cancer 8492 3.59744480851341E-12
pituitary cancer 1972 2.96587933622522E-8
adult high grade glioma 2148 9.42059653592729E-8
Pick disease 1893 1.98242288066033E-7
malignant mesothelioma 3163 4.16505401796766E-7
atypical teratoid / rhabdoid tumor 4369 6.15305855249067E-7
Duchenne muscular dystrophy 602 9.77517267595927E-7
pilocytic astrocytoma 3086 1.98714219132416E-6
medulloblastoma 1524 2.82163531822035E-6
glioblastoma 5572 3.55674798595854E-6
juvenile dermatomyositis 1189 1.0058890925788E-5
medulloblastoma, large-cell 6234 1.05924338631534E-5
psoriasis 6685 2.47994735167359E-4
cystic fibrosis 1670 3.33887823255937E-4
invasive ductal carcinoma 2950 4.75283720653735E-4
breast carcinoma 1614 4.83351220970893E-4
lung cancer 4473 5.69823536105335E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00196068877564661
Down syndrome 548 0.00947572467839909
colon cancer 1475 0.0109756839011239
progressive supranuclear palsy 674 0.0133373245448939
primary Sjogren syndrome 789 0.0256400509315153
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0267330616092085
Breast cancer 3099 0.0284503698011079
Alzheimer's disease 644 0.0314660004484393
osteosarcoma 7933 0.0362607062450635
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0373262040273397
adrenocortical adenoma 134 0.0379655758294618
Endometriosis 535 0.041592829090098

Expression

Synonym

Accession Q9UI56
Symbols GTL2
FP504
prebp1
PRO0518
PRO2160
LINC00023
NCRNA00023
onco-lncRNA-83

Gene

Gene RIF (52)

PMID Text
26850851 Our results indicated fenofibrate inhibited pancreatic cancer cells proliferation via activation of p53 mediated by upregulation of MEG3.
26823857 Downregulation of lncRNA MEG3 was associated with poor overall survival of osteosarcoma.
26718650 conditional logistic regression analysis revealed the aberrant expression of CTD-2541M15, UCA1 and MEG3 closely linked with Gastric cancer
26676363 DNMT1 was involved in MEG3 promoter methylation.
26647875 cells. These findings are the first to identify that adenosine increases MEG3 expression by inhibition of DNA methylation and its antitumor effects is involved in MEG3 activation
26610246 demonstrated that MEG3 inhibited the expression of cell cycle regulatory protein Cyclin D1 and induced cell cycle arrest in G0/G1 phase
26574780 causing inhibition of proliferation and increased apoptosis in cervical cancer cells. In summary, our findings indicate that MEG3 function as a tumor suppressor by regulating miR-21-5p, resulting in the inhibition of tumor growth in cervical cancer.
26333487 Paternal uniparental disomy chromosome 14-like syndrome due a maternal de novo 160 kb deletion at the 14q32.2 region does not encompassing the IG- and the MEG3-differentially methylated regions.
26321746 Dendrosomal curcumin interacts with miRN29 to upregulate MEG3 in hepatocellular cancer
26284494 Data support the hypothesis that MEG3 is a lncRNA tumor suppressor in the pituitary and its inactivation contributes to clinically non-functioning pituitary adenomas development.
More...

AA Sequence

MQSRDTVNVKFTPRSFWGSRPKHTGGRSEMRAHVPQAPWARQAPPVLPLWTVVNDHPHEKPVSRPQNT        1 - 68
//

Text Mined References (69)

PMID Year Title
26850851 2016 Fenofibrate inhibited pancreatic cancer cells proliferation via activation of p53 mediated by upregulation of LncRNA MEG3.
26823857 2015 Decreased expression of long non-coding RNA MEG3 acts as a potential predictor biomarker in progression and poor prognosis of osteosarcoma.
26718650 2016 Differential expression profiles of long non-coding RNAs reveal potential biomarkers for identification of human gastric cancer.
26676363 2016 Epigenetic repression of long non-coding RNA MEG3 mediated by DNMT1 represses the p53 pathway in gliomas.
26647875 2016 The mechanism of adenosine-mediated activation of lncRNA MEG3 and its antitumor effects in human hepatoma cells.
26610246 2015 Long Non-Coding RNA MEG3 Inhibits Cell Proliferation and Induces Apoptosis in Prostate Cancer.
26574780 2016 Long noncoding RNA MEG3 is downregulated in cervical cancer and affects cell proliferation and apoptosis by regulating miR-21.
26333487 2015 Paternal uniparental disomy chromosome 14-like syndrome due a maternal de novo 160?kb deletion at the 14q32.2 region not encompassing the IG- and the MEG3-DMRs: Patient report and genotype-phenotype correlation.
26321746 2015 Dendrosomal curcumin increases expression of the long non-coding RNA gene MEG3 via up-regulation of epi-miRs in hepatocellular cancer.
26284494 2015 Tumor suppression by MEG3 lncRNA in a human pituitary tumor derived cell line.
More...