Property Summary

NCBI Gene PubMed Count 69
PubMed Score 0.00
PubTator Score 19.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UI56
Symbols GTL2
FP504
prebp1
PRO0518
PRO2160
LINC00023
NCRNA00023
onco-lncRNA-83

Gene

Gene RIF (52)

PMID Text
26850851 Our results indicated fenofibrate inhibited pancreatic cancer cells proliferation via activation of p53 mediated by upregulation of MEG3.
26823857 Downregulation of lncRNA MEG3 was associated with poor overall survival of osteosarcoma.
26718650 conditional logistic regression analysis revealed the aberrant expression of CTD-2541M15, UCA1 and MEG3 closely linked with Gastric cancer
26676363 DNMT1 was involved in MEG3 promoter methylation.
26647875 cells. These findings are the first to identify that adenosine increases MEG3 expression by inhibition of DNA methylation and its antitumor effects is involved in MEG3 activation
26610246 demonstrated that MEG3 inhibited the expression of cell cycle regulatory protein Cyclin D1 and induced cell cycle arrest in G0/G1 phase
26574780 causing inhibition of proliferation and increased apoptosis in cervical cancer cells. In summary, our findings indicate that MEG3 function as a tumor suppressor by regulating miR-21-5p, resulting in the inhibition of tumor growth in cervical cancer.
26333487 Paternal uniparental disomy chromosome 14-like syndrome due a maternal de novo 160 kb deletion at the 14q32.2 region does not encompassing the IG- and the MEG3-differentially methylated regions.
26321746 Dendrosomal curcumin interacts with miRN29 to upregulate MEG3 in hepatocellular cancer
26284494 Data support the hypothesis that MEG3 is a lncRNA tumor suppressor in the pituitary and its inactivation contributes to clinically non-functioning pituitary adenomas development.
More...

AA Sequence

MQSRDTVNVKFTPRSFWGSRPKHTGGRSEMRAHVPQAPWARQAPPVLPLWTVVNDHPHEKPVSRPQNT        1 - 68
//

Text Mined References (69)

PMID Year Title
26850851 2016 Fenofibrate inhibited pancreatic cancer cells proliferation via activation of p53 mediated by upregulation of LncRNA MEG3.
26823857 2015 Decreased expression of long non-coding RNA MEG3 acts as a potential predictor biomarker in progression and poor prognosis of osteosarcoma.
26718650 2016 Differential expression profiles of long non-coding RNAs reveal potential biomarkers for identification of human gastric cancer.
26676363 2016 Epigenetic repression of long non-coding RNA MEG3 mediated by DNMT1 represses the p53 pathway in gliomas.
26647875 2016 The mechanism of adenosine-mediated activation of lncRNA MEG3 and its antitumor effects in human hepatoma cells.
26610246 2015 Long Non-Coding RNA MEG3 Inhibits Cell Proliferation and Induces Apoptosis in Prostate Cancer.
26574780 2016 Long noncoding RNA MEG3 is downregulated in cervical cancer and affects cell proliferation and apoptosis by regulating miR-21.
26333487 2015 Paternal uniparental disomy chromosome 14-like syndrome due a maternal de novo 160?kb deletion at the 14q32.2 region not encompassing the IG- and the MEG3-DMRs: Patient report and genotype-phenotype correlation.
26321746 2015 Dendrosomal curcumin increases expression of the long non-coding RNA gene MEG3 via up-regulation of epi-miRs in hepatocellular cancer.
26284494 2015 Tumor suppression by MEG3 lncRNA in a human pituitary tumor derived cell line.
More...